SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15921562|ref|NP_377231.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921562|ref|NP_377231.1|
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1e-23
Family eIF5a N-terminal domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 69-130
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000006
Family Cold shock DNA-binding domain-like 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15921562|ref|NP_377231.1|
Sequence length 131
Comment translation initiation factor IF-5A [Sulfolobus tokodaii str. 7]
Sequence
MSIQYTTVGDLKVGNYVVIDGEPCRVVEISKAKTGKHGSAKANIVAIGLFTGQKRTLMAP
VDQQVEVPIIEKHIGQILADKGDTITIMDMENYETFDIEKPTDADIVDKIRPGAEVEYWE
IMGRKKIVRVK
Download sequence
Identical sequences Q971T0
gi|15921562|ref|NP_377231.1| 273063.ST1296 WP_010979318.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]