SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15921621|ref|NP_377290.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921621|ref|NP_377290.1|
Domain Number 1 Region: 12-120
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.32e-16
Family MarR-like transcriptional regulators 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921621|ref|NP_377290.1|
Sequence length 132
Comment hypothetical protein ST1340 [Sulfolobus tokodaii str. 7]
Sequence
MIRVAYQIYKSFCTCHVAVCIYSLHILSIIYYVKRTELTEMQQRVLLFLLENDGSAFRDI
SDKTESNPNAIKKAIDELMELGLVYDKREDTFPRRRLIYLTEYGKEVAKRLKEIVEIINE
SSKHPQKPSVEV
Download sequence
Identical sequences 273063.ST1340 gi|15921621|ref|NP_377290.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]