SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15921679|ref|NP_377348.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921679|ref|NP_377348.1|
Domain Number 1 Region: 4-58,133-348
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.54e-51
Family NOL1/NOP2/sun 0.00055
Further Details:      
 
Domain Number 2 Region: 83-133
Classification Level Classification E-value
Superfamily PUA domain-like 0.0000242
Family Hypothetical RNA methyltransferase domain (HRMD) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921679|ref|NP_377348.1|
Sequence length 349
Comment Sun family protein [Sulfolobus tokodaii str. 7]
Sequence
MVERLNYDEFVMEDLKNVYKGFINDFLRSILVPNSRLYVRVNTLKINVEEILAELNFLER
DEDFEEALFVKLKGPNKIEEHETKVIVDKRTAESVIMGADVYRPGIKKVLGNGKYVNVVS
ENGVIVGEGELVNKGNLVVRVLNPLYSAPKFADLEYVKDGSLILQGKASMYVAHLLDPKP
NEKIIDMTAYPGGKLTHIYQLEPRSKVIGFDHTKKKVDELREKVKKMKMNIEVYLADSRY
LYEGFGLRDVDKVIIDPPCSALGIRPKVYDRKTKEDIINFHNYQRQFINSAYKILKKNGI
LVYSTCTVTTWENEKVIDDERFEVEDIIRFHPNIHDMTGFFIAKLIKRK
Download sequence
Identical sequences Q971G3
gi|15921679|ref|NP_377348.1| WP_010979435.1.60790 273063.ST1390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]