SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921761|ref|NP_377430.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921761|ref|NP_377430.1|
Domain Number 1 Region: 157-437
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.32e-80
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000613
Further Details:      
 
Domain Number 2 Region: 7-113
Classification Level Classification E-value
Superfamily tRNA-binding arm 2.98e-24
Family Seryl-tRNA synthetase (SerRS) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921761|ref|NP_377430.1|
Sequence length 453
Comment seryl-tRNA synthetase [Sulfolobus tokodaii str. 7]
Sequence
MSWSILELVRNNPDKLKEYIKRRFIDVSLVDRAVELDKKWRQTLQEVEKLRHEHNVISSS
IPKAKPEERQELIKKAKELLKALEEKEKELDNIENERDNILMQLPNIVDDSAPIGPDETY
SVPIRFWGKFKVYEKDEAEFLSQLKGNRVDYEIIHWKPVGHADMLENVLKLGDTKKAAEV
SGARFYYLFDDIVWLDIALLNYAIDTMTSKGYTLVLPPYMLRGEVIKSVIDLDTFKDAIY
KIENEDLYLIATAEHPIAALYFKEEIPKEKLPLKYVGISPAFRKEAGAANKDLKGIFRVH
QFHKVEQFIFSSPEDSWKLHEELIRNAEEIFQGLGLPYRVINIATGDLGACAAKKYDLEV
WMPAQAKFREMVSCSNCLDWQAYRMRIRYVEKGGKKGYVHTLNSTAIASTRTITAILENY
QREDGVVEIPKVLKKYLEPFSRAPKDYIYPRKE
Download sequence
Identical sequences Q970Y4
gi|15921761|ref|NP_377430.1| 273063.ST1469 WP_010979517.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]