SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15922385|ref|NP_378054.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922385|ref|NP_378054.1|
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.17e-33
Family Translational machinery components 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15922385|ref|NP_378054.1|
Sequence length 137
Comment 30S ribosomal protein S9P [Sulfolobus tokodaii str. 7]
Sequence
MSQQSQVIITYARRKMARARCYITPGKGRVFVNDIPLEIIPMEVVRMKIMEPLLLAGEKI
SSSIDAKIYVEGGGVMGQADAARMALARALVKFTGSKELEEIYKVYDRTMLAGDPRQTES
EKWMRYSARRWRQKAYR
Download sequence
Identical sequences Q96YW3
273063.ST2064 WP_010980139.1.60790 gi|15922385|ref|NP_378054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]