SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922494|ref|NP_378163.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922494|ref|NP_378163.1|
Domain Number 1 Region: 172-507
Classification Level Classification E-value
Superfamily Subtilisin-like 5.89e-67
Family Serine-carboxyl proteinase, SCP 0.000039
Further Details:      
 
Domain Number 2 Region: 722-799
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000436
Family I set domains 0.072
Further Details:      
 
Weak hits

Sequence:  gi|15922494|ref|NP_378163.1|
Domain Number - Region: 25-134
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00034
Family Subtilase propeptides/inhibitors 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15922494|ref|NP_378163.1|
Sequence length 1082
Comment hypothetical protein ST2167 [Sulfolobus tokodaii str. 7]
Sequence
MWSLLFLILIISSSLALPIYLQPQVSSQIPSNQLVNVAIVLPPKNLGLLQIYVQQHKIVN
QSQLISLFIPNATINKIVSILKYNGINPQVTLNVISFQAKAGVIEKLFNGEFVTTTILGK
KIYYFVSEGSSSFPGIVLATNLTSLFLSKPNNLVNITQAVAYNMVTPIEIQKAYNITYLL
NRGINGSGVNIGILDFEGDPYIYQQLQDFDSIYGLPNPPLFKIVPIGPYNPNDGIASGWA
LEISLDVEYAHAAAPDAGIILYVANPAISIPQAIAYIDQQDEVSVVSQSWGIPEIYFLLG
LLPMSYLQAMIYEYWLGEAEGITFIAASGDAGGNGYNFFLSPLGSTIVPSSIPYVLSVGG
STLYISGNESYQTAWSGESIFGSTTGGYSAIFPSPPYQGLKGYRITPDIVADANPYSGVP
IVYYYNTTYLVGGTSLATPIVAGIIALATQVHGRLGFINPLIYALNGTKAIVPINVGYNT
PYEANESLNPVTGLGYINAGYFVNLLKKPLISLSLAVQNTTYLLNQEIQVVAYLKGASSY
PSSITAYVYNGTSVVFSFPLIYNGSAYVGKISIDKSGVYEIYASYDNTYGFTYIIVGYQA
VFIFPIVAIYPVPTSIPVLVMITYPNGTLVSSYNSTTLLVYKENQIDGSLSQVGSARLNN
LPVVNISQLGISIKFKSGILEGYINLTSSKFGGVYVLSVNNTIGLDEIVLGMYIVPAVIP
NSFTEPTSIYSGENITIEVLVESLGLPNITVSFIKDGKVYYSTQINSILYNGASYYIAQI
SVPRLPDGYYTIEAYGEYSNGSYVTYGAGYTQIYVSSQKLILNASISSVAFENSSVIVKA
KIYYPNGTPVKFGIFSAIFVPNYLMSQLDNLEISYSVSLSYKNGEWIGNFTIPEGSYDNS
GLTIDELAGVWNVYLVGISSNGIPLPFNSSLNYNTLNIEPTSTGLSFLVLPYNYVPQFNG
NYAYHIYAPKAVIENKTVILIDSIIENLTAINSVIYSYNTQIYHATLINSKIENITKVSA
NIQNVEVVNSTNITRPTITSTESNTTVSLPNYGDAFIIEFIIAIVINAIVVTLFVITDRN
KR
Download sequence
Identical sequences Q96YK5
WP_010980247.1.60790 gi|15922494|ref|NP_378163.1| 273063.ST2167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]