SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15922613|ref|NP_378282.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922613|ref|NP_378282.1|
Domain Number 1 Region: 5-73
Classification Level Classification E-value
Superfamily SirA-like 0.0000000000314
Family SirA-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15922613|ref|NP_378282.1|
Sequence length 75
Comment hypothetical protein STS239 [Sulfolobus tokodaii str. 7]
Sequence
MSQQLKLDLRGKPCEEYILEISKILVSMKAGDVLIVIADQDRIICTHQLLRNSPRYLFKA
DIVGDHAEITIRRLR
Download sequence
Identical sequences Q96Y86
273063.STS239 WP_010980366.1.60790 gi|15922613|ref|NP_378282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]