SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15922669|ref|NP_378338.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922669|ref|NP_378338.1|
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.5e-20
Family Hypothetical protein Ta1423, N-terminal domain 0.0066
Further Details:      
 
Domain Number 2 Region: 68-150
Classification Level Classification E-value
Superfamily PUA domain-like 2.38e-19
Family PUA domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15922669|ref|NP_378338.1|
Sequence length 159
Comment putative RNA-binding protein [Sulfolobus tokodaii str. 7]
Sequence
MQRHFLSEKDSKKLISEIKNKYGINIEGRIEIGKEKKEVYYFIDGLLSFFSEELIPTLCF
IRKYNLQLPSVTVDEGAVKHIINGADLFVPGIVEYNCNCKEGDIVLVKTKTNIPIAIIKV
IMDKERALSEKKGKFGINLHYINDKIWEMCNERGSSSNV
Download sequence
Identical sequences Q96Y30
273063.ST2338 WP_010980422.1.60790 gi|15922669|ref|NP_378338.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]