SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15922901|ref|NP_378570.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922901|ref|NP_378570.1|
Domain Number 1 Region: 161-383
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 6.75e-71
Family ATP sulfurylase catalytic domain 0.0000146
Further Details:      
 
Domain Number 2 Region: 19-160
Classification Level Classification E-value
Superfamily PUA domain-like 7.75e-45
Family ATP sulfurylase N-terminal domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15922901|ref|NP_378570.1|
Sequence length 412
Comment sulfate adenylyltransferase [Sulfolobus tokodaii str. 7]
Sequence
MTQFIGHGRVEVVERTLRDFSEFKELNKIDVRRQLAHEIIGIAFGFFSPLKGFMTFNEVD
SVVNDMRLPNGILWPIPLVFDVNETNGIKEGDVIGITYMGKPLAIMHVKEIFTYDKAYMA
EKVYKTRDIKHPGVKRTLNYANKFIGGDIWLIKEPKFSHPYTDFWLTPRQHREVFERKGW
KNIVAFQTRNVPHTGHEYLMKYAWFAANGSEKVEEPKTGILVNVVIGEKRIGDYIDEAIL
LTHDALSKYGYISRRIHMLSFTLWDMRYAGPREAVLHAIIRSNIGCTHHVFGRDHAGVGN
YYSPYEAHKIFDMIDEKDLIIKPIFLRENYYCPKCGSIENEMLCDHKDERQEFSGSLLRS
VILDEVKPTKMVMRPEVFDILMKAAKEYGFGSPFVTEEYLEKRRKIFDLGDY
Download sequence
Identical sequences F9VPI0
gi|15922901|ref|NP_378570.1| 273063.ST2568 WP_010980653.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]