SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15920607|ref|NP_376276.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920607|ref|NP_376276.1|
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Pseudouridine synthase 6.62e-39
Family Pseudouridine synthase II TruB 0.0000158
Further Details:      
 
Domain Number 2 Region: 151-231
Classification Level Classification E-value
Superfamily PUA domain-like 2.15e-18
Family PUA domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15920607|ref|NP_376276.1|
Sequence length 237
Comment tRNA pseudouridine synthase B [Sulfolobus tokodaii str. 7]
Sequence
MSYISSSGKEYVCLMQVHCDFNIDELKQIISKFIGIIYQKPPVRSSVKRRTRKKKIYDIE
ILDTDKRFILLRISSDPGTYMRKLCHDIGVILGCGAHMRELRRIRSGIFTEKNLVTLQEI
SEALYMWKNCKDESDLRKILLPMEYATCGMPKILIDDNAVDAISYGAMLTAPGIVAYQRF
RVKDTVAILTLKGELVAIGEADVDSQKLVDMKKGIVVKPKRVLMPRDIYPRSWKKHG
Download sequence
Identical sequences 273063.ST0402 WP_010978368.1.60790 gi|15920607|ref|NP_376276.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]