SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15921139|ref|NP_376808.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921139|ref|NP_376808.1|
Domain Number 1 Region: 494-562
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000000147
Family Transglutaminase, two C-terminal domains 0.0057
Further Details:      
 
Weak hits

Sequence:  gi|15921139|ref|NP_376808.1|
Domain Number - Region: 605-671
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00497
Family Transglutaminase, two C-terminal domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15921139|ref|NP_376808.1|
Sequence length 869
Comment hypothetical protein ST0903 [Sulfolobus tokodaii str. 7]
Sequence
MKRLSLLLVLFLLISPLLSLALPTTSTNFSATAQWEVTPPYNVAPGETLVPAQVTLTYNG
EFTLYNVIIKPYNFPAISPFTSNTTYEISKIEPGQQLSLVFLVNISPSIPLGVYNFYISI
YNSSIVFPDCVVSAQLPVLGYVNLYATAQASGILFPGERDVPIDITIYDTGSVSATDVTL
FLNSSYPIQFVTKEVKVPEISTTTPATVQVLANVYSNATVGTYQLKLTALVFGTLYKSLN
VSVSINSNQTVEGKLLNPSVIDDIGSYQDNVPINLQLEYTGPVEINSYSIIITLPQGFTN
ESGGNEIIINGGSVQPNEIIPLTFSLNTKNINLTSYTFPIKIIWNAVEGEGEIVSVVQYI
SFTLIAMGNNEIQITPLTSILYSNSINNVTILLTNQGSGNIYNVTLSVSSPQASILSYKS
QIPEIKAGQSVSIPIELFIPEALQGNSLSITISLNYLNSMYEESQYSQELGFYVASKNYV
PILISLNPPILSPGEFQSTQLILQNTLNTTLYNVSISLSSQGIYLNNTVFEIHTISPHGN
YTVPIELFSSSPGTYTLTVSVSYFDSLVQNSEELNIPIYFSQLNAPSVPILLTLNYTVLT
YDILQNAKLLITNTLNEPIYNVTISLSSQGEIYVNNTIITLPELKPLETLSIPIKVYVGT
TGIVSISASMSYYISGQQKESEELINSLAAGSVDLVVTSVTTLNVGTIISVTGTIYNFGT
GSANGLTVIAEPTRGLQVVGQNTYYVGNLGPDTSSTFTFAFRILNVTAFNRTAFNGFSDP
SSFTRSFANFTGRVFLVPIEFVYTNDIGQVIHTYSNITIHVTNSSEAFTTLTFHSTTTHG
RFFTLIGILILVVIVIVVVVLVLRRRRKE
Download sequence
Identical sequences Q973J5
gi|15921139|ref|NP_376808.1| 273063.ST0903 WP_010978900.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]