SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15921368|ref|NP_377037.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921368|ref|NP_377037.1|
Domain Number 1 Region: 5-179,337-424
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.19e-53
Family Bacterial dinuclear zinc exopeptidases 0.0029
Further Details:      
 
Weak hits

Sequence:  gi|15921368|ref|NP_377037.1|
Domain Number - Region: 186-231,273-326
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00155
Family Bacterial exopeptidase dimerisation domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15921368|ref|NP_377037.1|
Sequence length 426
Comment hypothetical protein ST1113 [Sulfolobus tokodaii str. 7]
Sequence
MLTEEEKQYALKKYVEFLQHPSISATGEGIRETASWLKEFMEELGIKATIEETGGHPVVY
GEANNGGDKTLLVYNHYDVQPVDPLNEWKYPPFSAIIENGHIYGRGASDNKGVLIARLIA
FSKYKGNLSFKFLVEGEEEIGSVNLPNYVERKKPKADAVIMEGAGLDTKGRPMIVLGVKG
LLYVQLTVRTASKDIHSSNAPIVYNPVWELIKILNEIYDGERVKLKGFYNDIEPLSDEMK
ELLAKLDIDMEELRKSLGAYKLKGNIREIYIEPTCNIDGIYSGYIGKGSKTIVPAYAFAK
IDFRLVPNQDPKKVFSSLLEVVKDRAEVEVFGMEKPVRTSPNAKVVKAMINSAKKVYSLD
PVVIPNSAGTQPMGVFYDLGIREIVSAIGVGTPSSNAHAPNENVKLENFYKAIEHAYEFF
NEYSSV
Download sequence
Identical sequences Q972L9
WP_010979127.1.60790 gi|15921368|ref|NP_377037.1| 273063.ST1113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]