SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|223477213|ref|YP_002581705.1| from Thermococcus sp. AM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223477213|ref|YP_002581705.1|
Domain Number 1 Region: 12-244
Classification Level Classification E-value
Superfamily PP2C-like 1.57e-44
Family PP2C-like 0.0000431
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|223477213|ref|YP_002581705.1|
Sequence length 247
Comment serine/threonine protein phosphatase [Thermococcus sp. AM4]
Sequence
MDAKWLCLPYLCAVSDVGARSNNEDGFIVEKLPSGYYLGIADGLGGHAAGEVASEIALTA
AKRVVVDEYEDGIDGQLLRLLLRKAHELANSAVLEEAVGERKGMGTTLLSAVIRGREVFL
ANTGDSRAQLIRDGDVVASTRDHNLLRELLDKGIALTKAEAMEASRRLTHVIGGRGKRFA
VDLYRWEARPGDWLLLSTDGLHDYLDAEAILDVLSRNEEPGKAVMELLREALGVTRDNVT
IILYRWW
Download sequence
Identical sequences B7R5D4
WP_014121580.1.59639 gi|223477213|ref|YP_002581705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]