SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223478710|ref|YP_002583360.1| from Thermococcus sp. AM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223478710|ref|YP_002583360.1|
Domain Number 1 Region: 618-855
Classification Level Classification E-value
Superfamily PP2C-like 1.31e-63
Family PP2C-like 0.00000729
Further Details:      
 
Weak hits

Sequence:  gi|223478710|ref|YP_002583360.1|
Domain Number - Region: 100-204,239-265
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00647
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 36-118
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 0.0837
Family Anticodon-binding domain of PheRS 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|223478710|ref|YP_002583360.1|
Sequence length 863
Comment Ser/Thr phosphatase [Thermococcus sp. AM4]
Sequence
MRILKKDAENLKQNWTWFFIFLVISSLVPSTPAVAAPASSGDLALKVNQSISEANLSLIL
LENYSPTLEFNITEIEKLRNETLRARILLTQGNVTLANETISSVWNSITSIINSKVRALN
ESLSTLKEKALNYSMECSSVMKEIQNETEKLADLPKTFYNVTEVNETLKQLASLNSKIQD
IRNELNSCIQRVDKIRRIKTKETFIDMVLKASSGLLSKNESEKFINQLKEIDGLIKSGDI
TRAFNDVIAEQKQLLSLINEKIENLNGKIKSSCPYIKPLLTIDIREVMNSNNRSLVISRI
REINRTKDELEQCISLQENIKLANRTLSILEKYQNNLKLNMTILEGYFNEALNGIKGGNL
TLSQLMLERFWNTTADSLNKLAAETENRTIREELKQLTWRIMEKNYPSVTEKLDDVLSMT
FSGSPTPFPGGTTTTTTTTTSINTTTTTTPITTKPSMNATTTNSTAGNMTGSTTSAKHSG
GINWTSILKIVILVLLGILVLLAAAWFGPEVYYNYKQQRQQKARIKAAEEAVKIMGEILR
DLQKKAKQLGITDSPTVYGLLNEMQQLYSRAVSSFRRGDYVTPTRIRDTFSVKAAKLNSI
IAAYETTFSLTDEEFKKHVAAKSYIGRRDNNEDYYIAKKIGGNILLAVADGMGGHLAGEV
ASRKAIEILEKTLERNKAENPEKILKEAIKKANDEIYIMGHDPDHPERYNMGTTLTAAII
RGNNATIGNIGDSRTYLIKKDGTIKRLTKDHSFVQELVDRGEITEAEARVHPQKNVLTKA
IGISPEIRIDPGDINTIQLKEGDYLLLCSDGLSDVLTDEEIAKTVVTSPSLEEAVQTLIE
KAYSFGSTDNITVVLYKHPRLKR
Download sequence
Identical sequences B7R0M2
WP_014121465.1.59639 gi|223478710|ref|YP_002583360.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]