SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr11P01050_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr11P01050_001
Domain Number 1 Region: 125-175
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000157
Family alpha-D-mannose-specific plant lectins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr11P01050_001
Sequence length 280
Comment pep:novel chromosome:MA1:11:726417:727334:-1 gene:GSMUA_Achr11G01050_001 transcript:GSMUA_Achr11T01050_001 description:"Putative expressed protein"
Sequence
MPFKSLPPSPCMHPIAAFSPSSETAMDLLLSFSLLPTLFLVLLLLSPAAQATTVAGTIER
TTKQQVLASIPPHAADTSVPFLTSPSGKYTACLLRRETAPGAGGFGNDFCYIQVQDTSTG
RSMWESDTPVWDTGAQSADNNFLQTLELVDHGDMRIRDKDGELAWKASDDPRANQGCGLP
GSPGLAPALPPFAVPIGGDDQNLPFGRPASGGQQLPQSNTMYDQQQQQHPLGGASQAFGF
DGQPLVDNSPYDSGCYGEGAGRWVGVGVALLLLLLLPVLA
Download sequence
Identical sequences M0RND6
GSMUA_Achr11P01050_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]