SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr1P07640_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr1P07640_001
Domain Number 1 Region: 98-170
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000641
Family alpha-D-mannose-specific plant lectins 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr1P07640_001
Sequence length 313
Comment pep:novel chromosome:MA1:1:5894169:5895290:-1 gene:GSMUA_Achr1G07640_001 transcript:GSMUA_Achr1T07640_001 description:"expressed protein"
Sequence
MASFFLFLCISSLILCPPSQADDANAVHTPLGTIQRETKQQILATVPPNPSGNTEPFLTS
PLGKYVGYLLRRETAPGAGGMGNDFCYIQIQEAASGASVWESECEPVSSANACSLVFCDA
GLALFDGSNPVWDTGASGHNNFPATLELVDHGDMRVIDKDGELVWKASDDARVNQHCGLP
GSPGLPSGAPPFVGPIGGDDNPPFGQQPQQTTPYPTNGALPLAPANGDLPLAPAHPPVVA
PTGGADDLAAGVLPSTNPINGAFGQQQQPHGLHGVTEQPLVDNTPYDSGSSGKEGSVVLF
FSAVVGHLMLYGF
Download sequence
Identical sequences M0RXX2
GSMUA_Achr1P07640_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]