SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr1P22330_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr1P22330_001
Domain Number 1 Region: 74-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-28
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr1P22330_001
Sequence length 390
Comment pep:novel chromosome:MA1:1:16804042:16805470:1 gene:GSMUA_Achr1G22330_001 transcript:GSMUA_Achr1T22330_001 description:"Hypothetical protein"
Sequence
MAQLLALCLSEFFLLFTFSAHAGAADDSLFRGQSLSGGQTMVSGGGKVELGFFAPGNSSK
YYIGIWYKVSKQPVVWVANREKPVASASSSELTLAEDGNLVLRLKVSKNQIWSSNSSSSL
ASNSTVAVLLDDGNLVLKDNVTSDTLWQSFDHPTNAWLPGAKLGYNKLTGQDWFLTSWRN
PEDPSPGMFTMEFDPNGSDQFYLVRDRRHRYATSGLWTGDTFRVRDRAATHYIMLDFTGE
LRRQRWDNDDKVMLHVCRDSTHGLRMNGPWEITPEGASEEPLYAVGKEIDSSSYPTRSRP
PTLCACQPSAVEKSVELLACGIVRQNQELFMFVLTLQNWRLMITRTGKRRRRFSSEQCQV
LLLSLSSSCFWPRDTAKGQPSEVQEAFMAL
Download sequence
Identical sequences M0S241
GSMUA_Achr1P22330_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]