SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P18970_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P18970_001
Domain Number 1 Region: 502-761
Classification Level Classification E-value
Superfamily Mitochondrial carrier 7.59e-57
Family Mitochondrial carrier 0.00091
Further Details:      
 
Domain Number 2 Region: 342-472
Classification Level Classification E-value
Superfamily EF-hand 9.22e-20
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P18970_001
Sequence length 775
Comment pep:novel chromosome:MA1:4:19999920:20010177:1 gene:GSMUA_Achr4G18970_001 transcript:GSMUA_Achr4T18970_001 description:"Putative S-adenosylmethionine mitochondrial carrier protein"
Sequence
MVYGQDPSEALLQAVRDALSPLESAVLCAARDLESQQAVAVSVVASEDRKKGPIKSFLGA
LLPNCSRGDGVRGRTGNSSKKGRGEDDKDKSRVNCSPFAATWSLVLNSFLQACPRPLKSV
RKCFGNQCREDESLSEPRRGKTARRGSYKVAYWDKTDKSASVDGETLSLELIFCFALDSL
VQNLQMLNLSHQRSSAKKYDQPRASDSSWPPQFDHLKTIEGLINGKKADFDGVLSNLGFA
RVGGAPASFVGATSSVNTEGASHANCDDKEEPMSRSPQKVASGLLNIPLSNVERLKSTLS
TVSLAELVEFMPHLGRSSSDYPDKKKLFSVQDFFRYTEAEGRRFFEELDRDGDGQVNLED
FEIAMRKRKLPRRYAKDLLRRTRSNLFSKSIGWKQFLSLMEQKEPKILRAYTTLCLSKSG
TLQKNQILTSLRSAGLPASEDNAIAMMRYLNVDSEGSISYSHFRNFMLLLPSERLEDDPR
NIWFEAATVVSVPPPVEISTGSVLKSALAGGLASALSTSVLYPVDTMKTRVQASTLSFPE
LVAKLPEIGFRGLYRGSIPAILGQFSSHGLRTGIFEASKLVLINVAPTLQELQVQSMASF
CSTILGTAVRIPCEVLKQRLQAGIFDNVGEAIVGTLHQDGLRGFFRGTGATLCREVPFYV
AGMCLYAEAKKAAQNILDRDLTPWETVAVGALSGGLAAVVTTPFDVMKTRMMTAPQGLPV
SMSTVAFSILGQEGPLGLFKGAVPRFFWIAPLGAMNFAGYELAKKAMVKTEPISG
Download sequence
Identical sequences M0SQ60
GSMUA_Achr4P18970_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]