SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P05990_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P05990_001
Domain Number 1 Region: 227-506
Classification Level Classification E-value
Superfamily Mitochondrial carrier 8.37e-79
Family Mitochondrial carrier 0.0000423
Further Details:      
 
Domain Number 2 Region: 49-227
Classification Level Classification E-value
Superfamily EF-hand 1.95e-33
Family Calmodulin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P05990_001
Sequence length 514
Comment pep:novel chromosome:MA1:5:4458793:4462533:-1 gene:GSMUA_Achr5G05990_001 transcript:GSMUA_Achr5T05990_001 description:"Putative Calcium-binding mitochondrial carrier protein SCaMC-1"
Sequence
MSGAAKAVEERSGFSAKMDAAPAAEGEQRRRPDGCNPVKKPGPVSMDHVLLALRETGEER
EVRVRSLFNFFDAAGVGHLDYAQIDSGLSALRVPAEYKYARDLLKVCDANRDGRVDYQEF
RRYMDDKELELYRIFQAIDVEHNGCILPEELWDALIKAGIDIDDEELARFVEHVDKDNNG
IITFEEWRDFLLLYPHEATIENIYQYWERVCLVDIGEQAVIPEGISKHVNPSKYLIAGGV
AGAASRTATAPLDRLKVALQVQTTRARILPAIKDIWREGGFLSFFRGNGLNVIKVTPESA
IKFYTFEILKDFIVKGKGEEKSNIGASERLIAGGIAGAVSQTVIYPMDLVKTRLQTYACE
AGKVPNLAMLTRDIWVHEGPRAFYRGIVPSLLGIIPFAGIDLAAYETLKDMSRTYILKNS
DPGPLMQLGCGTISSALGATCVYPLQVIRTRMQAQRTNPSNNYYGMSDVFWRTLKNEGLL
GFYKGIIPNLLKVVPAAGITYLVYETMKKSLSLD
Download sequence
Identical sequences M0SW28
GSMUA_Achr5P05990_001 XP_009399747.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]