SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P18830_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P18830_001
Domain Number 1 Region: 568-759
Classification Level Classification E-value
Superfamily Sec7 domain 2.09e-79
Family Sec7 domain 0.00000117
Further Details:      
 
Domain Number 2 Region: 335-506,849-913,1060-1228,1262-1327,1356-1432
Classification Level Classification E-value
Superfamily ARM repeat 1.23e-18
Family Armadillo repeat 0.043
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr5P18830_001
Domain Number - Region: 83-238,286-440
Classification Level Classification E-value
Superfamily ARM repeat 0.00905
Family PHAT domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P18830_001
Sequence length 1712
Comment pep:novel chromosome:MA1:5:20329659:20342538:1 gene:GSMUA_Achr5G18830_001 transcript:GSMUA_Achr5T18830_001 description:"Putative Brefeldin A-inhibited guanine nucleotide-exchange protein 2"
Sequence
MASPEADSRLPLVLAPALEKIVKNASWRKGHSKLAHQCKSLIDRLSHPPPPPSPSSPNSS
SSLPGPLRDGGSAVYSLADSEIFLAPLIAACSSGSPRVAEPALDCVQRLVAHSYLHGEAD
PAGGPDARLLAQLIDAVCGSLALSGGGDDALELLVLKTLLSAVTSTALRIHGDALLQIVR
TCYDLYLGSKNPVNQTTAKASLIQMLVIVFRRMEADSSTVPVQPIVGFITRIISDIDTTA
VENTNPADLLDSTDKDMLDAKYWEISMYKTALEDRKDELGPEGVVDRDDEAEVQIGNKLR
RDAFLVFRALCKLSMKTPPKEAVADPALMKGKIVALELLKILLENAGAVFRTSERFLGAI
KQYLCLSLLKNSASAHLIVFQLSCSIFMSLVSRFRPGLKAEIGVFFPMIVLRVLENVAQP
IFQQKMIVLRFLEKLCVDSQILVDIFINYDCDVHSSNIFERMVNGLLKTAQGPPPGAPTT
LVPPQDVTMKFEAMKCLVAILRSMGDWMNKQLRIPDPYSQNTETADGNTGGSNELPLGNG
NSEEPAEVSDSHSETANGTSEVASIELRRAYKLELQEGISLFNQKPKKGIEFLINAKKVG
DSPEEIAAFLKSASGLNKTLIGDYLGEREDLSLKVMHAYVDSFDFEGMKFDEAIRCFLQG
FRLPGEAQKIDRIMEKFAERYCKCNPKAFTSADTAYVLAYSVIMLNTDAHNPMVKNKMSP
DDFIRNNRGIDDGKDLPEEYLRSLYDRISKNEIKMKEDNLAPQQIQSSNSNKILGLDGIL
NIVIRKRHSSTETSDDMIRHMQEQFKEKARKSESAYYSATDVVILRFMIEVCWAPMLAAF
SVPLDQSDDETVISLCLEGFRSAVHVTAVMSMETQRDAFVTSLAKFTSLHSAADIKQKNI
DAIKAVLYIADEDGNYLQEAWEHVLTCVSRFEHLHLLGEGAPPDATFFTIQQTELDTSNQ
TKSSILTTTKKKGPSSVQMNNLISNLNLLEQVGIAEVNRIFVRSEKLNSEAIINFVKALC
KVSMEELRSASDPRVFSLTKIVEIAHYNMNRIRLVWSSIWSVLSEFFVTIGCSENLSIAI
FAMDSLRQLAMKFLERKELANYNFQNEFMKPFVIVMRKSRAVEIRELIIRCFSQMVLARV
SNVKSGWKSMFMVFATASYDDHKNIVLLAFEIIEKILRDYFPYITETETTTFTDCVNCLI
AFTNSRFNKDISLNAIAFLRFCAAKLAEGDIGASARYKNKEAFVNNGPPSPHIIKDEKQD
TPLIIDKDDHLHLWFPLLAGLSELTFDLRPDIRQSALQVLFDTLRNCGHHFSLPLWEKVF
DSVLFPIFDSVRHDVDTPRGIPQGQGSENDTEELDQDAWLYETCKLALQLVVDLFVKFYD
TVNPLLKKVLTLLTSLIKRPHQSLAGIGITAFVRLMSSAGPLFVETKWEIVVLSLKEAAK
ATLPDFSYISSGAHLDNAASDNGNSPLMQENGESRGSIDDDSEGLRTRNLYSAIGDAKCR
AAIQLLLIQAVMEIYNMYRAQISAKNELLLFEALHAVACHAHKVNSDADLRSKLQEIGSL
TQMQDPPLLRLENESYHLCLVLLQNSVVDRPLNGDVEVEAHLVQLCREVLEVYLKAAKGQ
PVVASTGTQPRTHWLIPVGSGKRRELAARAPVVVSALHAISGLGDTPFRKNLALFFPLLS
CLISCEHGSTEVQVALSDMLNTWVGPILLRAC
Download sequence
Identical sequences M0SZR2
GSMUA_Achr5P18830_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]