SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P29310_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P29310_001
Domain Number 1 Region: 501-760
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.31e-57
Family Mitochondrial carrier 0.0011
Further Details:      
 
Domain Number 2 Region: 341-482
Classification Level Classification E-value
Superfamily EF-hand 2.57e-18
Family Calmodulin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P29310_001
Sequence length 774
Comment pep:novel chromosome:MA1:5:29103936:29112259:-1 gene:GSMUA_Achr5G29310_001 transcript:GSMUA_Achr5T29310_001 description:"Putative S-adenosylmethionine mitochondrial carrier protein"
Sequence
MVSGQDPVEAILHAFRDALSPLESGFLRAAKDLESHWLNSTDRSNNERKRSPIQGLLGAL
FPNASRVGSVRGRGGNSSKTGRDEEEKNGSCVDCSPFAVTWSIMLNSFVQAFPRPLKSFR
KCFGDQCHDDDFVSEPWHGKPSERAPYKIVFWDKSKKTSSADREMLPLELILCIALESLV
QNLQMLNLPCQGSSPQICNQPVASKSSGAPQFEHLKMINGLINGKKADFDGFLSNLSFAR
VGGAPANFVEDTPSAKAEDENHANSGDKEDTASSPPQNIASGLLNIPLSNVERLKSTLST
VSLTELIEFIPQLGRSATDYPDKKKLFSVQDFFRYAEVEGRRFFEELDRDGDGQLNLEDL
EIAMRKRNLPRRYAKDFLRRTRSYLFAKSIGWKQFLSLMEQKEPKILRAYTTLCLSKSGT
LQKNQILTSLRSAGLPASEDNAIAMMRSLNVDSEGSISYSHFRNFMLLLPSERLEDDPRN
IWFEAATVVAVPPPVEISTGNVLKSALAGGLACALSTSIMHPIDTMKTRVQASTLSFPEL
VSKLPEIGLRGLYRGSIPAILGQFSSHGLRTGIFEASKLVLINVAPTLQELQVQSMASFC
STILGTAVRIPCEVLKQRLQAGIFDNVGEAIVGTLHQDGLKGFFRGTGATLCREVPFYVA
GMCLYAESKKVAQNLLNRDLAPWETVAVGALSGGLAAVVTTPFDVMKTRMMTAPQGLPVS
MQMVAFSILRKEGPLGLFKGAVPRFFWIAPLGAMNFAGYELAKKAMDKTEHVPE
Download sequence
Identical sequences M0T2Q5
GSMUA_Achr5P29310_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]