SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P35490_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P35490_001
Domain Number 1 Region: 83-160,258-280
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000102
Family alpha-D-mannose-specific plant lectins 0.0065
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr6P35490_001
Domain Number - Region: 354-393
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000334
Family Pan module (APPLE domain) 0.045
Further Details:      
 
Domain Number - Region: 104-133,164-308
Classification Level Classification E-value
Superfamily NHL repeat 0.0366
Family NHL repeat 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P35490_001
Sequence length 492
Comment pep:novel chromosome:MA1:6:33677653:33679131:-1 gene:GSMUA_Achr6G35490_001 transcript:GSMUA_Achr6T35490_001 description:"Putative PAN domain-containing protein At5g03700"
Sequence
MAANKQLHALVFLLSYLVTRPAWFGNGASSAAQEIRKGFSVTHDSSYSEFQSLLADPTGV
FSLGFLRVDSSQLDLAVIHLPSSSALWRANPARPLLWSASASLSFDGSLVLSDSRTGVLW
STATADGDRLVLLNSSNLQIQKMAGAAATVLWQSFDFPSDTLVQDQNFTSTAALFSKDQR
FSMRLGASYFALYMDLDGGSTPVMYWKHSALDVKVLIVPDEGPIYARVDAHGFLGMYQKE
AAPVDVFPFDSFNREISGLRRLTLESDGNLRAYYWNGSIWVRDLETIAHRCELPAVCGAY
GLCNSADSRCSCLDNSTEEGCLPPGSGHFCGDGGSEFRILRRNGVDLANQELVAYRKVAS
LEECEGSCEQNCSCWGAIYHNASGFCYPLDYPIQTLVEGDMRREGYFKVRVRTSGGGGGA
GRTARVALLVVGSVVFAGAALFGAYSLWSRRRQMRAGMDGSMVEGLAPGSYKDLNSASFR
SLELSNSFSLRK
Download sequence
Identical sequences M0TCZ2
GSMUA_Achr6P35490_001 XP_009407347.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]