SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr7P01950_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr7P01950_001
Domain Number 1 Region: 136-247
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-20
Family alpha-D-mannose-specific plant lectins 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr7P01950_001
Sequence length 435
Comment pep:novel chromosome:MA1:7:1532738:1538250:-1 gene:GSMUA_Achr7G01950_001 transcript:GSMUA_Achr7T01950_001 description:"Putative S-locus-specific glycoprotein S13"
Sequence
MKVGLLCVQERPEDRPTMSSVLFMLGSDSALLPQPRQPGFVAMRGPLEPDSSTSKQDSLS
INNVSVTMFEVVASGPSRLGSGPNGGDHARSPSGVYDTGADTLTFDHPLADGGEPLISEG
GSFALGFFSPNGSDSRYIGIWYKKISVQTVVWVANRQRPVAGSHGSLSVATNGTLVITGE
NSTVVWSSPSLTLSDPVAHLLDDGNFVLGWNLTTGFNRTLTSWASANDPAPGEYTFGIDL
RGDPQIFEWSGTRQFVVDATQVVYVFHTIDIWNVSRLVVNQSGTLQRLPKNPTNWGFRDG
SDGCVRKTAVDCRNGTDGFVLVSGAKLPDTGSGSGCILWSTNLTDLRVFGSGGQDLYVRA
AAADVGMYSSVSLSLDRWLREARSRWRLGADACQRRPERRVMARVSHDRLLYDLEKGSHD
RLLYDLEEGSHDRLL
Download sequence
Identical sequences M0TDY5
GSMUA_Achr7P01950_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]