SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr7P02450_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr7P02450_001
Domain Number 1 Region: 280-392
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.72e-31
Family Thioltransferase 0.00036
Further Details:      
 
Domain Number 2 Region: 118-213,252-277
Classification Level Classification E-value
Superfamily TPR-like 3.53e-20
Family Tetratricopeptide repeat (TPR) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr7P02450_001
Sequence length 396
Comment pep:novel chromosome:MA1:7:1938400:1944958:1 gene:GSMUA_Achr7G02450_001 transcript:GSMUA_Achr7T02450_001 description:"TPR repeat-containing thioredoxin TDX"
Sequence
MDTHKVSELKAFVTSCRSDPSILHHPSLAFFRDYLQSLGARLPPQAMSKNPMKGENDDEM
TKAAPDSVDKKPYQKPEDAAIEDEIIESDMELDGELVEPDNGPPQKMGDPSTEVSEESRK
LDESIEFLTEAILLNPSSAILYATRASVFVKLHKPNAAIRDSDAALQINPDSAKGYKYRG
MAKAMLGQWEEAASDLHVASKLDYDEEINSVLKKVEPNAHRIEEHRRKYERLRKEREAQK
IERERQRQRAEANAVYERGKKESTSENKAFDAEPKDPDSLAALQDGSVISIHSSNELQTK
MTAAVRLSRLVILYFTATWCGPCRFMAPIYKALAEKHRNIVFLKVDIDELGNDAHRWNVN
SVPTFFFVKDGKEVDKVVGADKSGLERKIAMHAAKP
Download sequence
Identical sequences M0TE35
GSMUA_Achr7P02450_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]