SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P19420_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P19420_001
Domain Number 1 Region: 575-766
Classification Level Classification E-value
Superfamily Sec7 domain 8.11e-77
Family Sec7 domain 0.00000148
Further Details:      
 
Domain Number 2 Region: 368-514,742-796,832-920,1090-1258,1292-1357,1386-1467
Classification Level Classification E-value
Superfamily ARM repeat 6.91e-18
Family Armadillo repeat 0.031
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr8P19420_001
Domain Number - Region: 81-233,304-476
Classification Level Classification E-value
Superfamily ARM repeat 0.00576
Family MIF4G domain-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P19420_001
Sequence length 1742
Comment pep:novel chromosome:MA1:8:24686193:24696522:1 gene:GSMUA_Achr8G19420_001 transcript:GSMUA_Achr8T19420_001 description:"Putative Brefeldin A-inhibited guanine nucleotide-exchange protein 2"
Sequence
MASAEADSRVALLLVPALEKIVKNASWRKGHSKLAHQCKSLIDRLSHPPSSPPPSSPNSS
SSLPGPLRDGGAAVYSLADSETYLAPLVAACTSGSPRVAEPAIDCVQKLIAHSYLYGEAD
PSGGPDARLLAELVEAVCGCYALGGAEDALELLVLKTLLSAVTSTALRIHGDSLLQIVRT
CYDLYLGSKNPVNQATAKASLIQMLVIVFRRMEADSSTVPVQPIVGFITKIISDIDGVLN
PSTPLARTASASKHDGAFVSTAVENTNPADLLDSTDKDMLDAKDDDTEVQIGNKLKRDAF
LVFRALCKLSMKTPPKEAVVDPAHMKGKIVALELLKILLENAGAVFRTSERLIGITLVGD
TFLFLGAIKQYLCLSLLKNSASAHLIVFQLSCSIFMSLISRFRPGLKAEIGVFFPMIVLR
VLENVAQPNFQQKMIVLCFFEKLCVDSQILVDIFINYDCDVHSSNIFERIVNGLLKTAQG
PPPGAPTTLIPPQDTTMKFEAMKCLVAILRSMGDWMNKQLRIPDPQSQKTETIDGSGDSN
ELTLANGNGDETAEVSDSNSDTPNGTSEVASIEQRRAYKLELQEGISLFNQKPKKGIEFL
INAKKVGDVPADIAAFLRSASGLNKTLIGDYLGEREDLSLKVMHAYVDSFDFQGMEFDEA
IRCFLKGFRLPGEAQKIDRIMEKFAERYCKCNPKAFTSADTAYVLAYSVILLNTDAHNPM
VKNKMSPDDFIRNNRGIDDGKDLPEEFLRSLFDRISKNEIKMKEDNLALQQIQSSNSNRI
LGLDSILNIVIRKRDSPTETSDDMIRHMQEQFKEKAHKSESIYYSATDVVILRFMIEVCW
APMLAAFSVPVDQSDDETVISLCLEGFRSAVHVTAVMSMKTQRDAFVTSLAKFTSLHSAA
DIKQKNIDAIKAILHIADEDGNYLQEAWEHILTCVSRFEHLHLLGEGAPPDATFFTIQQT
EVDKAKQAKSSILPVLKKKGPSSIVARRGTYDSAGVGGHASGAVTSEQMNNLISNLNLLE
QVGIAEVNRVFIRSEKLNSEAIIDFVKALCKVSMEELRSTSDPRVFSLTKIVEITHYNMD
RIRLVWSSIWNVLSEFFVTIGCSENLSIAIFAMDSLRQLSMKFLERKELANYNFQNEFMK
PFVIVMRKSRAVEIRELIIRCVSQMVLARVSNVKSGWKSMFMVFATASYDDHKNIVLLAF
EVIEKILRDYFPYITETETTTFTDCVNCLVAFSNSRFNKDISLNAIAFLRFCAAKLAEGD
IGASARLKDKEASGSIGPPSPHIIKDEKQDPPSIINKDDHLHLWFPLLAGLSELTFDLRP
DIRQSALQVLFDTLRNYGNHFSLPLWEKVFDSVLFPIFDSVRHAVDPSGATLQGQGLEND
TAELDQEAWLYETCKLALQLVVDLFVKFYDTVNPLLEKVLTLLTSFIKRPHQSLAGIGIT
AFVRLMSNAGSLFVETKWEVVVLSLKEAAKATLPDFSYISSGAYLDSATSENGNSSLRQD
NGESRGSADDDFEGLRARNLYFAIGDAKCRAAVQLLLIQAVMEIHNMYKAQISAKNTLIF
FEALHVVACHAHKVNSDTDLRSKLQELGSMTQMQDPPLLRLENESYHSCLVLLQNIVTDR
HRNSNLEAEASLVDLCNEVLEVYIRTATGQSGEASTGAQPISHWLIPVGSAKRRELAARA
PVVVSTLQAISGLGDTSLEKNLARFFPLLAGLISCEHGSSEVQLALSDMLSTRVGPVLLR
AC
Download sequence
Identical sequences M0TRU5
GSMUA_Achr8P19420_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]