SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P26070_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P26070_001
Domain Number 1 Region: 228-507
Classification Level Classification E-value
Superfamily Mitochondrial carrier 6.15e-78
Family Mitochondrial carrier 0.0000503
Further Details:      
 
Domain Number 2 Region: 50-228
Classification Level Classification E-value
Superfamily EF-hand 1.92e-33
Family Calmodulin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P26070_001
Sequence length 515
Comment pep:novel chromosome:MA1:8:29745787:29748921:1 gene:GSMUA_Achr8G26070_001 transcript:GSMUA_Achr8T26070_001 description:"Putative Calcium-binding mitochondrial carrier protein SCaMC-1"
Sequence
MSGATKAVEERILFPAKMEEAAPASDGEQWRRPGGCNPVKKPGPVSMDHVLLALRETKEE
REVRIRSLFNFFDAAGVGHLDYVQIEAGLSALCIPAEYKYARDLLKVCDANRDGRVDYQE
FRRYLDDKELELYRIFQAIDVEHNGCILPEELWDALIKAGIEIDDEELVRFVEHVDKDNN
GIITFEEWRDFLLLYPHEATIENIYQYWEKVCLVDIGEQAVIPEGISKHVNASKYLIAGG
LAGAASRTVTAPLDRLKVVLQVRTTQARIMPAIKDIWRDGRFLGFFRGNGLNVMKVAPES
AIKFYTFEMLKDFIVTAKGEEKSDIGASGRLIAGGLAGAVAQTAIYPLDLVKTRLQTYAC
EGGKVPNLATLTKDIWVHEGPRAFYKGLIPSLLGIIPYAGIDLSAYETLKDMSRTYILKD
SEPGPLVQLGCGTISGALGATCVYPLQVIRTRMQAQHTNSSSAYNGMSDVFWKTLRNEGF
SGFYKGIIPNLLKVMPSASITYLVYETMKKSLYLD
Download sequence
Identical sequences M0TTR0
GSMUA_Achr8P26070_001 XP_018686465.1.42102 XP_018686466.1.42102 XP_018686467.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]