SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP03960_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP03960_001
Domain Number 1 Region: 228-506
Classification Level Classification E-value
Superfamily Mitochondrial carrier 9.15e-79
Family Mitochondrial carrier 0.0000444
Further Details:      
 
Domain Number 2 Region: 50-227
Classification Level Classification E-value
Superfamily EF-hand 7.93e-34
Family Calmodulin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP03960_001
Sequence length 514
Comment pep:novel chromosome:MA1:chrUn_random:17663419:17666870:1 gene:GSMUA_AchrUn_randomG03960_001 transcript:GSMUA_AchrUn_randomT03960_001 description:"Putative Calcium-binding mitochondrial carrier protein SCaMC-1"
Sequence
MSGAAKAVEHRIGFPTKMEATAPAADGEQQRRPGGCNPVKKPGPVSMDHVLLALRETKEE
REVRIRSLFNFFDAAGVGQLDYAQIEAGLSALRIPTEYKYARDLLKVCDANRDGRVDYQE
FRRYMDDKELELYRIFQAIDVEHNGCILPEELWDALIKAGIEIDDEELARFVEHVDKDNN
GIITFEEWRDFLLLYPHEATIENIYQYWERVCLVDIGEQAAIPEGISKHVNASQYLIAGG
VAGAASRTATAPLDRLKVVLQVQTTQARIVPAIKDIWREGHFLGFFRGNGLNVMKVAPES
AIKFYTFEMLKDFIVKTKGEEKSDIGASGRLTAGGLAGAVAQTAIYPLDLVKTRLQTYAC
EGGKVPNLTTLTKDIWVHEGPRAFYRGLVPSLLGIIPYAGIDLTAYETLKDMSRTYILKD
SEPGPLVQLGCGTISGALGATCVYPLQVIRTRMQAHTNSSTAYNGMSDVFWKTLRNEGFS
GFYKGIFPNLLKVVPSASITYLVYETMKKSLTLD
Download sequence
Identical sequences M0U658
XP_009385809.1.42102 GSMUA_AchrUn_randomP03960_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]