SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP13550_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP13550_001
Domain Number 1 Region: 92-212
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.41e-18
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 
Weak hits

Sequence:  GSMUA_AchrUn_randomP13550_001
Domain Number - Region: 177-265
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.0366
Family Putative isomerase YbhE 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP13550_001
Sequence length 456
Comment pep:novel chromosome:MA1:chrUn_random:64405652:64407096:1 gene:GSMUA_AchrUn_randomG13550_001 transcript:GSMUA_AchrUn_randomT13550_001 description:"curculin-like lectin family protein, putative"
Sequence
MGLRCVFFLLFAFLPRVFSALSFPVGGRVTIPVPSAYQPGFVGRAFVLAAGNAPPDFRAA
LSVEAIAGAGYSCSVVVLLGDVKVWASDHVAKFIPAGRCVLELTPDGDLQLMDRAGRIGW
RSGTSGLGVKSLLLKKNTGNLVLADARNQTRWQSFEHPTNTMLWGQRLNASSRLTSFPVN
SSSFYSLEVHKDKLVAYLNWRGERYSYWELQPRAGRSIAYTRVGSTGLKVFDVNSWKIAQ
ILAMKSGAVRFLALGSKGNLGLYYYSASHGKFEPSCRALELCDLPLPCGPYGICSSTNTC
AYLQLSGMEYSTSFCGLASSEVEMVELRSVVTVLRTSSSASNVSKEECLASCLEDCSCAA
ALHTNGHGVGTGEWCSRYALVGGAREVEVGATESSYWIKVARKGSARHETSASLVTKVLI
VGGVVDAVALCVILGGLVYYFFKIRKRSVDSGTNNS
Download sequence
Identical sequences M0U8W4
XP_009386863.1.42102 GSMUA_AchrUn_randomP13550_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]