SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000014 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000014
Domain Number 1 Region: 248-470
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.54e-56
Family Reprolysin-like 0.00045
Further Details:      
 
Domain Number 2 Region: 561-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000353
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 908-964
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000288
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 4 Region: 848-904
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000288
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 5 Region: 1019-1074
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000562
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 6 Region: 968-1022
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000249
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000014   Gene: ENSTNIG00000013493   Transcript: ENSTNIT00000003593
Sequence length 1122
Comment pep:novel chromosome:TETRAODON8:4:4394773:4423092:1 gene:ENSTNIG00000013493 transcript:ENSTNIT00000003593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEILWKTLTWTLSLVVMAASDLQNLNRLSHNSQDKEELLSYLQHYQLTVPVRVDENGEFL
SYTVKHHRPGRRMHPPEPRLFYRLSAYGKHFHLNLTLNPQLVSRHFTVEYWGKDGLEWRH
NTVDNCHYVGFLQNQHGTTRVALSNCKGLHGVITTEEEQYLIEPLKNTSSTTSGEWSLEE
AQQHVIYKMSAIPSPQEPSQEFSCGLSDLIKSSPPCQLSSPSPPHPSAEPKNGSEPSGGG
RRRRRSVSSERFVETLVVADKMMVGYHGRKDIEHYILSVMNIVAKLYRDASLGNVVNIIV
TRLIVLTEDQQPNLEINHHADKSLDSFCKWQKTISTHHSGGNSIPDNGVAHHDNAVLITS
RYDICTYKNKPCGTLGLASVAGMCEPERSCSINEDIGLGSAFTIAHEIGHNFGMNHDGIG
NSCGTKGHETAKLMAAHITANTNPFSWSACSKDYITSFLDSGRGTCLDNEPLKRDFLYPT
VAPGQVYGADEQCRFQYGASSRQCKYGEVCRELWCLSKSNRCVTNSIPAAEGTLCQSGSI
EKGWCYQGECVAFGTFPQSLDGDWGPWSTWGECSRTCGGGVSSSMRHCDSPAPSGGGKYC
LGERKRYRSCNIDVQCFFQSRDFREKQWADFDSMPFRGKYYNWKPYAGAGGVKPCALNCL
AEGYNFYTERSPAVIDGTRCQADSLDICINGECKHVGCDNILGSDAKEDRCRVCGGDGST
CETTEGLFNDSLPRGGYMEVVQIPKGSVHLEIKELAMSKNYIALKSKEEDYYINGAWTID
WPRKFDIGGTTFHYKRPADEPESLEALGPTTKNLVVMVLLQEQNQGIRYKFNVPIQRTGS
GDNEVGFSWNHLPWSECSTTCSGGSQKQEVVCKRLDDNSVVQNNYCDPDGKPPENQRDCN
TEPCPAEWLIGDWSECGKTCDGGIRTRTVVCIRKISPTVEETLEDVHCLTRRPIEQESCN
NQSCPPKWVTLDWSECTPRCGPGFKHRIALCKSSDLTKTFPPAQCPSQSKPPVRVRCSLG
RCPPPRWTPGEWGQCSAQCGLGQQMRTVQCLSYTGQPSNECLETLRPAMMQQCESKCDAA
PVSNSDECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTCQGH
Download sequence
Identical sequences H3D7J7
ENSTNIP00000000014 ENSTNIP00000016488 99883.ENSTNIP00000016488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]