SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000219 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000219
Domain Number 1 Region: 536-604,831-1170
Classification Level Classification E-value
Superfamily Ras GEF 7.06e-122
Family Ras GEF 0.0000181
Further Details:      
 
Domain Number 2 Region: 139-361
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.16e-44
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 3 Region: 349-505
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000517
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000219
Domain Number - Region: 9-63
Classification Level Classification E-value
Superfamily PH domain-like 0.000142
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000219   Gene: ENSTNIG00000011363   Transcript: ENSTNIT00000000354
Sequence length 1171
Comment pep:novel chromosome:TETRAODON8:5:2374386:2386870:1 gene:ENSTNIG00000011363 transcript:ENSTNIT00000000354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSSQEASWRHEYYFTVTFNHDNQKALELRTEDAKDCDEWVAAITQARYSYRNLATEHETL
MXKSVIISHDCDTMSVVRVLINSHGNTRQRAVAEIIGLLKDNEKIQANPEVPPSEDDTEI
KKIKKVQSFLRGWICRRKWKTIIQDYIRSPHAESMRKRNQVVFSMLEAEAEYVQQLHILV
NNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARIASWPTLVLADLF
DILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKQYEAKPDCEERTLETFLTYPMF
QIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMI
VDGCEVLLDTSQTFVRQGSLIQIPMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICT
RGSGGKLYITKNGVVSLIDCTLMEEPEGTDDESKAERSGQDTEHLDFKVIVEPKDSQAYT
VILVASLRQEKSAWTSDISQCIDNIRCNGLMMNAFEENSKVTVPQMIKSDTSLYCDDVDI
RFSKMMNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTSADVVLDKLITI
YRKPISAIPARSLELFFASGQNNKLLYGEPPTSPRASRKFSSPPPLSITKTSSPNRRRKL
SLNIPIITGGKALDLAALSCSPNGYTCMHSMSPFSKTTLDINKLYVSSSMASKISDDGEP
KAEGKAEESVLGKQVDLSVREECDKDPSQSDETEAEMSPPKSPSTPNSLLAEFSLFSFNN
GMVVSSCRELDNNRSALSAASAFAIATAGANEGTPTKEKYRRMSLASTGFPTDQRNGDKE
FVIRRAATNRVLNVLRHWVTKHSQDFEMNAELKIRVIGFLEEVMHDPELLTQERKAAANI
IRTVTQEDPGDNQVTLEEIDQMAMLDCKTEPFENHSALEIAEQLTLLDHLVFKVIPYEEF
FGQGWMKTGKNERTPYIMRTTKHFNDISNRIATEILHCDDVNMRAAVIEKWVAVADICRC
LHNYNALLEITSSLNRSSIFRLKKTWLKVSKQTKTVIDKIQKLVSSEGRFKNLREALKNC
DPPCVPYLGMYLTDLAFIEEGTPNYTEDNLVNFSKMRMISHIIREIRQFQQTAYKIDYQP
KVARYLLDSSRALDEESLYEASLRIEPKSSS
Download sequence
Identical sequences H3BW57
99883.ENSTNIP00000000219 ENSTNIP00000000219 ENSTNIP00000000219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]