SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000279 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000279
Domain Number 1 Region: 344-509
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 7.32e-59
Family IP3 receptor type 1 binding core, domain 2 0.0000000475
Further Details:      
 
Domain Number 2 Region: 1032-1194
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.48e-33
Family IP3 receptor type 1 binding core, domain 2 0.0075
Further Details:      
 
Domain Number 3 Region: 109-211
Classification Level Classification E-value
Superfamily MIR domain 2.79e-18
Family MIR domain 0.015
Further Details:      
 
Domain Number 4 Region: 285-338
Classification Level Classification E-value
Superfamily MIR domain 0.000000000256
Family MIR domain 0.00015
Further Details:      
 
Domain Number 5 Region: 1146-1243,1332-1418,1447-1600,1880-1990
Classification Level Classification E-value
Superfamily ARM repeat 0.00000504
Family PBS lyase HEAT-like repeat 0.054
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000279
Domain Number - Region: 2595-2645
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0628
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000279   Gene: ENSTNIG00000014554   Transcript: ENSTNIT00000001716
Sequence length 2663
Comment pep:novel chromosome:TETRAODON8:11:7694528:7762581:1 gene:ENSTNIG00000014554 transcript:ENSTNIT00000001716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPDAGDLNNPPKKFRVLLFLI
TPVSLFSSKHQFWHCGSAVAMATSIILFTLLNLVTHAYDPTKPEQEXENKKLLGTVIQYG
NVIQLLHLKSNKYLTVNKRLPALLEKNAMRVMLDTAGNEGSWFYIQPFYKLRSIGDSVVI
GDKVVLNPVNAGQPLHASTHQLVDNPGCNEGLSATGLHXPICGEGKYIFQIVKSPCDSHY
FPSNLKKEIYFKSNQQEKNTNTIMNKQLKTCRSLPSVLVRKKCYFKIDCFCRNSYVRLRH
LCTNTWVHSTNQPIDKEEEKPVMLRIGTSALKEDKDGLLCPVSPAEVRDLDFANDASKVL
ASIAGKLEKGTITQNERRAVTKLLEDLVFFVVDIPNSGQDVLEIMVNKPNRERQKLMREQ
NILKQIFKLLQAPFTDSGDGPMLRLEELADQRHAPFRHICRLCYRVLRHSQQDYRKNQEY
IAKQFRFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDY
LSDLCVSMNKSIPVTQELICNAVLDPANADILIETKLVLSRFEIEGAPLGENSLESEEDE
EEVWLFWKDNNNKEIRSKSIRELAQDAKEGQKEDQEVISYYRYQLNLFARMCLDRQYLAI
NKISGQLDVDLILRCMSDEDLPFDLRASFCRMMLHMHVDRDPQEQVTPVKYARLWSEIPS
EIAIDDYDNDGTSKDEIKERFSQTMEFVENYLRDVVCQSFPFADKEKNKLTFEVVNLARN
LIYFGFYNFSDLLRLTKILLAILDCVHIGTAFGFNKLDKDDESKGSNVMRSIHGVGELMS
QVVLRGGGFLPMTPSISTSRDTVKTQTEPEKQDILVMDTKLKIIEILQFILNVRLDYRIS
CLLSIFKREFDESNSQSELPVGGAVEGPNNMPGALDFEHIEEQAEGIFGGSEENTPLDLD
DHGGRTFLRVLLHLTMHDYPPLVSRALHLLFRHFSQRQEVLQAFKQVQLLVTSQDVENYK
QIKSDLDQLRSIVEKSELWVYKRQGSEEGMDTGEGLCAEPEHKLVPYFENSLSNKTKKPE
STSSYNYRVVKEILLRLSKLCVQEGLSGRKSKKQQQRLLRNMGAHSVVLELLQIPYEKGE
DLRMQDIMKLAHQFLQNFCAGNQQNQALLHKHINLFLNPGILEAITMQHIFMNNFQLCSE
INERVVQHFVHCIETHGRNVQYLKFLQTIVKAENKFIKKCQDIVMAELVNAGEDVLVFYN
DRASFQTLVQMMRSERDRMDENSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIV
RVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEIYTSNHMWKLFENFLVDICRVCNSTSD
RKHADTILERYVTETVMSIVTTFFSSPFSDQSTSLQTRQPVFVQLLQAVFRVYHCNWLIP
VQKGSVENCIKVLSDVAKGRAIAIPVDLDNQVHNLFVKSNNIVQKTAMSWRLSARNAARR
DSVVTASRDYRNIIERLQDIVSALEDRLRPLVQAELSVLVDVLHRPELLFPENTDSRKKC
ESGGFICKLIKHTKQLLEENEERLCIKVLQTLREMMTKDRGYGEKKKKFSIFPSRWGSVT
VPRNKDIKGKCVQQLGHNQPEKLLEDQKRGEALRQILVNRYYGNFHRSGGRRDSLTFANS
PLSPIGPGRNQSGLGVPGGLSRGEMSLAEVQCHLDKEGASDLVIDLIMNTTSDRVFQESI
LLAIALLEGGNTTIQRSFFCRLTEDKKSEKFFRVFYDRMKLAQLEIKATVTVNTSDLGNR
KRVDDSQDKDGPVRKKVRESSVVMTEDVREQLLEASSATKKAFNSYRREADPEDHFNVAD
GQSNTGDKNQDDGEMSFVIVIMQPILRFLQLLCENHNRDLQNFLRCQNNKNNYNLVCETL
QFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLTEYCQGPCHENQNCIATHESNGID
IIIALILNDINPLGKKRMDLVLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEV
IKKAYLLGEVEIQDTKEEDKFRGEPRNLYTEHNHYVETHRICMTFFSFEKKKKIGGVVAV
KFCRTLTEFISFYASLKIQRRATLGTPTQCMFVPLHLSLPHHSSSNKKVAKLSSFLLRFR
SLFLSQNVTKQIRAQPVLYWCSRNMSVWSNICFNLALLMNLLVCLFYPLEGVQGVMLDPH
LSAMLWMGVFAALVIVLVMPQQLSVRALVIITILRLIFSVGLEPTLFLLGAFNVCNKIIF
LISFVGNRGTFTRGYKAMVLDFEFLYHLIYLIICCLGVFVHVFFYSLLLFDLVYREETLL
NVIKSVTRNGRSIVLTAVLALILVYLFSIVGYIFFKDDFILEVDRVPNATITFLPKGGGS
LASVFVPTGMCQGGIDQNCTAKAQLEDMMDNKDKDDDVERTCDSLLMCIVTVLSHGLRSG
GGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKEEIL
KTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLFFIVLVKVKDSTEYTGPESYVAEMI
KEHNLDWFPRMRAMSLVSSDAEGEQNEIRNLQEKLESTMRLVANLSGQLSELKEQMTEQR
KQKQRIGLLGHPPHMNINPQQPA
Download sequence
Identical sequences H3C3R6
99883.ENSTNIP00000002885 ENSTNIP00000000279 ENSTNIP00000002885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]