SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000331 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000331
Domain Number 1 Region: 246-457
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.01e-59
Family Reprolysin-like 0.00073
Further Details:      
 
Domain Number 2 Region: 542-599
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000222
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 3 Region: 1584-1642
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000746
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 950-1000
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000249
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 5 Region: 1470-1533
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000811
Family TSP-1 type 1 repeat 0.0085
Further Details:      
 
Domain Number 6 Region: 829-885
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000017
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 7 Region: 1425-1475
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000366
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 8 Region: 880-945
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000706
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000331
Domain Number - Region: 1544-1584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00235
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000331   Gene: ENSTNIG00000009562   Transcript: ENSTNIT00000003836
Sequence length 1692
Comment pep:novel chromosome:TETRAODON8:5:10631479:10660444:1 gene:ENSTNIG00000009562 transcript:ENSTNIT00000003836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQASPRSSPPPLLKSAISLLSGPLPLPPWFPTGRRLPDLPQYDVVHPTRVDARGRFLSNL
LSHHVRRVQRREAAGRSADADPVFYRLWHNGRSLRFNLTLNAGLLAPGFLTERRYGGLEG
AQIGAAAPSSRCHFLGEVWDEEAVKGRAAISACDGLTGLFRLSGEEFFIQPLEESSLQSS
APQAHAIYKRHAAPPSGPHVLQPLAGKQTLNGTCGNKSLADIERQRERWERRRLRKRRRI
RQRSVSKEKWVETLVVADPKMVEYHGSHSVENYILAVMNIVAGLFGDASIGNAINVVVVR
LILLEKDEDDLKITHHADNSLLSFCKWQKKLNTKGDDHPLHHDVAVLLTRKDICAAVNVP
CETLGLSHVAGMCQAHRSCSISEDTGLPVAFTVAHELGHNFGIQHDGNGNDCEPVGKRPF
VMSPQLLYGTSLPKWSRCSRDYITRFLDRGWGWCLDDAPVKNKQSGHWVLPGVLYSAVHQ
CRLQYGSRSRLCDDVDNVCSTLWCTVGTTCHSKLDGAVDGTSCGEDKWCFGGECVAVGHQ
PAIVHGGWGSWSEWSTCSRTCGAGVQRAHRDCDNPVPKHRGKYCLGERRRYKVCSIPACG
QEEPTFRHVQCSHFNALPYKGKFYQWEAVFNRAGPCELHCRPLNENFSEKMRDARHRRTP
CYEGNKSRDMCINGICKKVGCDYVVESSAVEDCGVCKGDGSTCATVRRTFEESEGLGYVD
IGLIPEGAREIRIQEVAEAGNFLALRSDNPNKYFLNGGWTIQWNGDYKAAGAVFTYERTG
HLENLTSPGPTTEPLWIQLLFQEPNPGVRYEYTINRNTSDNNNLTASSFFWKFGSWAECS
VTCGAGVQRQIVHCVERMMGIVEEHWCDPSTRPNDNQTSCRRDPCPAVWWVGEWHKCSAS
CGSSGQTRRTVLCVQAVSVDEQKARPSSECEHVPKPTSLSTCNTHIVCPADWTAGNWSKC
SLTCGGGVRRRNISCSRNTGIDCDPQKKPPAVSACSIQDCPPEEDQFGPEWSGSGWSSNE
INSIPEMKAAPRHSSTRAQPTPGSAADTAGDFHYHNNIEGIDRSPESSVRVDDFYYDYNF
INFHEDLSDDFESDGNGAEGVFGTPQDAEPTAPNATVGTPEARNLDPTEDSGDEDSVGLE
DLLSEDYLLPVSTTDSPPVRHSQKEKNGRHGFPAKDVNEAEVEKGLGLTADSLPDNVDMS
ATNPGYHTTLSGVPTSPTSAPVGNDHVYVYSYYKGSTLSPGNQERFQSVQMEESASEIPR
TPSQSVVSTSGFRLGGLEPDHSAFRTHATGGYSWNTHSNPTSASLSASEDSRPTFPTFLQ
TSGNQQASVISTSPGTGTKPPTGLEEATRTPPANLLPAAGKYDPTESPVTEGGGAELPPQ
APWFDVTTEAPHRGPPTTTHPAVFGPFLLPTSVQSTASAQATFPGYWITGNWSACSTSCG
LGAVWRTLSCSSGSDSDCDPAKRPAPAQRCYLRPCASWRVQEWSKCSRNCEGGSKSREVT
CVDLRDERPLRPFHCRAVSSRPQAHLPCNLQPCLDWIRFLLGTDQCSDVCGGGEQQRVVE
CPEEDRCDPDLQPSSIQSCNDHLCVQWLTGSWGQCSASCGGGVQHRLIKCVNTKAEAEEV
EASQCDPELQPASTQNCNVQKCVRTPAGAVCTRDRLTSRFCQTLLWLGHCQLPNIRAQCC
RTCSQTLQGSRS
Download sequence
Identical sequences H3CW01
99883.ENSTNIP00000012435 ENSTNIP00000012435 ENSTNIP00000000331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]