SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000389 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000389
Domain Number 1 Region: 134-181
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000017
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 1226-1283
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000366
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 3 Region: 578-640
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000706
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 973-1019
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000994
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 305-358
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 1107-1158
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 7 Region: 716-769
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000034
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 8 Region: 1281-1332
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000127
Family TSP-1 type 1 repeat 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000389
Domain Number - Region: 897-972
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000122
Family TSP-1 type 1 repeat 0.013
Further Details:      
 
Domain Number - Region: 644-711
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000379
Family TSP-1 type 1 repeat 0.011
Further Details:      
 
Domain Number - Region: 1031-1101
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000458
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number - Region: 1162-1222
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000615
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number - Region: 56-129
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00157
Family TSP-1 type 1 repeat 0.011
Further Details:      
 
Domain Number - Region: 459-521
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00249
Family TSP-1 type 1 repeat 0.0091
Further Details:      
 
Domain Number - Region: 1-49
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0589
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 
Domain Number - Region: 848-898
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0916
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000389   Gene: ENSTNIG00000010989   Transcript: ENSTNIT00000002106
Sequence length 1598
Comment pep:novel chromosome:TETRAODON8:2:17048897:17077094:1 gene:ENSTNIG00000010989 transcript:ENSTNIT00000002106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQWSHCIGQECGSGGVQSRMTWCVHAEGWTAHHSHCQHMDKPESQRHCFKVCDWHQDLFR
WDVSDWGPCALVPFFGNEPAPRTADCITAQHGIQRRSIRCVRTSNTTAVSSRICEFFSQK
PLMEQACLIPCPQDCVVSDFTSWSSCSRTCGAGLQHRTRHVLATPMYGGANCPNLTDTRT
CSISVNCPAGEAEYQYSLKAGAWSECRLPHQKDLQLSGRTTVDFSTTSSENNTVTIHRQT
FKHHHNHHHHHANAHTRHPWFWDQEVGYQTRQVRCTRSDGKNVMLSLCTRDSSSLIVQTC
VMPKDCQTSDWSPWSPCSKTCRSADLSPGYRLRSRMVTQIPIGGGKQCPALEEKEACNII
GDLLSNCPRSQALRQKNEQLQINTDFLSSTLAQTNRSGKPSLLCGGGSRPEDLLCQMKEG
MASHGKNVGKEDNNISRPVNSRLCVSEEPPLAVQNCSVPCKHQCPVSEWSSWSACLFDNC
KDAEGKKGFRQRRREVLWESGSHLETCPHLVESIPCEDPTCFLWQIKEEPCIPTSGSCGH
GTAIQNVSCVSIEVGEVEPPASCEGEPPPSEVSCDLACAADCVVSHWSHWSPCSHSCATK
NSEGRQSRKRTVLALPGKDGKACPAATALEEWRVCNNHPCIVFHWETSAWGLCIENVSID
LNVTSLLDVTSTCPVGIQIRKVKCVKSNSGPVISKRCSDSARPEAIRPCAFPCKRDCVVT
PFSEWTACPSTCLPDNATVATQSRYRTIIQRSANGGQECPGTLYEERECDSLPVCPAYRW
RTHKWQSCILVPESVQRGLSGQGEACGNGLETRGISCVSESDQSANVTECLRWAGPMPPQ
IRECRVLCKDDCALTAWSRFTECSGCGSSRSRKRTLTGRSRKKEHCLNVELEQTEPCPCD
ELLSQPYGNWSACILPDPPAAGALKGWTSEREIKECGQGVRYRAVACVEQQGHLVDPTLC
TEMGFVVEVCHIPCPLDCKLSDWSAWSACSASCGSGLQMRSKWLREKAFNRGRPCPRLDL
KNQAQVYEAVPCHSDCSQYEWRVESWSICTINAVDDLPACGEGVQSRKIRCVKKGTSDEA
SGVDAGLCDQEEMPSRAQVCFLACPKDCVTSAWGAWSSCSLPCDSGTSRNRTRQILRLPA
SPQDSPCPDLVQSEPCVLNSTCFTHEYRVSDWSTCQLSENAVCGEGFRLRLLDCIRSDGK
VVEARKCEQLGLVNTWTLSESCVVDCPISCILSDWTPWTECSRTCGSQAFSSRTRRILQE
AHEEGRPCPSQLTQTKPCPIRPCYRWLISDWSPCILEGAQCGEGLQRRNLTCVVHWGDRA
ESASQPVQSEFCGDELLRKIQQEMEKPCFIPCPVMVCYPEDLKTESVCNLQSFVSNEMLR
KPAGGPVKRPSKSYLQGSWKNKGSCPHQVYESRPCKGGKCHSYQWRTGGWSNNERVVWCQ
RSDGVNVTGGCFLQKKPTTVRHCHPPCTKPFSHCTPSGVCGCEKGYTEVMTTHGFLDYCT
RTPGVDSSKKADVKTNSGRSKPQPPQGQDLFSEWTLRPIGPDGRVKLWVYAVTAVGFILI
LFVIALTFLLCTPSRTSKTSSPAPQKPLTLAYDGDIDM
Download sequence
Identical sequences H3BZP8
ENSTNIP00000000389 ENSTNIP00000001464 99883.ENSTNIP00000001464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]