SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000390 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000390
Domain Number 1 Region: 212-423
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.9e-54
Family Reprolysin-like 0.00052
Further Details:      
 
Domain Number 2 Region: 514-571
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.31e-16
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000390   Gene: ENSTNIG00000014538   Transcript: ENSTNIT00000003312
Sequence length 833
Comment pep:novel chromosome:TETRAODON8:3:5994974:5999018:1 gene:ENSTNIG00000014538 transcript:ENSTNIT00000003312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLRVCLAIIATLCVGAAHGAWEESVVVPVRLDPTTPTEPWRTLSVEEQQKQAERREYR
LEAFGRDLVLQLEPDQTFLAPGFVFHMVGSPDPDPTPEPKSGTEPGCFYSGTVNGEEHSA
AALNLCHGLRGGFYLQGAEYFIQPLNSSLLAGTEENVHMIRRRSRATLAEEGGSKCGVNE
DEKRVPINLEREAGGAVNGAQTVHHRTRRFVSTPRYLEIMIVADQSMAEFHGAGLKPYLL
TIMAVASRLYRHASIHNSISLAVVKLLVVYEEEHGPQVSSNAAMTLRNFCQWQRQHNPAS
DRHPEHYDTAVLFTRTDLCGAHSCDTLGMADVGTVCDPDRSCSIIEDDGLQAAFTVAHEL
GHVFNMPHDDAQMCSEVNGAHWGSHMMASTLSNLDQQQPWSPCSALMVTTFLDNGHGQCL
LDKPVRPQALPQPLPGSVYDADHQCRLTFGEDSQHCSDPNTTCAALWCTVTTPNGLLVCQ
TKNFPWADGTPCGHDSSCLAGQCLTRSQAAKHQIPVNGGWGLWGPWGDCSRTCGGGVQYS
FRSCDNPLPRNGGKYCEGKRIQYRSCNTETCPDTNGLTFREEQCLAHNDMSAQVSLGSGE
GVEWVPKYAGISPKDRCKLVCRAKGTGYFFVLKSKVADGTPCSPDSTTVCVQGQCVKAGC
DRIIGSNRRFDKCGVCGGDGSTCKKVSGSLVRARPGYQDVVTIPAGATHVDVKQRAAGNG
RHDNSYLAVRRQDGTYLLNGDYKLMTMETDIALRGALLRYSGSSTTLERIRSFSPLPEPL
TIQVLSVGEAPRPRVKYSYFAPRPNNGASTSNNGGRRQSINAITEVGGAEWTL
Download sequence
Identical sequences H3BWM8
99883.ENSTNIP00000000390 ENSTNIP00000000390 ENSTNIP00000000390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]