SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000400 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000400
Domain Number 1 Region: 526-716
Classification Level Classification E-value
Superfamily Sec7 domain 2.75e-66
Family Sec7 domain 0.00000561
Further Details:      
 
Domain Number 2 Region: 748-872
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000201
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000400   Gene: ENSTNIG00000017938   Transcript: ENSTNIT00000003699
Sequence length 972
Comment pep:novel chromosome:TETRAODON8:9:6989880:6995850:1 gene:ENSTNIG00000017938 transcript:ENSTNIT00000003699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCLQCNSEKTQSLMELELNGCVEGDGRPSDSGPSLDGGATYGQGPVTHGSAISPDRFES
PLYSQGVQPGPQRPRRPKLQHSQSILRKQAEEEAIKRSRSLSESYELSADLQDKQVEMLE
RKYGGRFITRHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQLSFEGPE
KVHSSYFEGRRVSMTEDGTPLSMMPSECGEVEVHQQANMASHPPPQGDLTDAITELEDTF
SRQVKSLAESIDDALNCRSLQGDEGTDAEAMGCHKLEREMPYQVKAHRKGGGRMDEETMA
SYSDVTLFIDEEDMSPSIALSRSGEQPSGTESDLRLRSVNSSQEYWPLDPKDEGRDTDTS
CRSTPSLECQDQRLRMDHLPLLTIEPPSDSSAELSDRSDRSSARRPPVYEPHIVTSSQAS
PKHILHGPPPRAPSRDDEAPLRHRHRQLEGHLAINGSTNRQSKSESDFSDGDNDSINSTS
NSNDTINCSSESSSRDSLREQTLSKQTYHKETRNSWDSPIFSNDVLRKRHYRIGLNLFNK
KPEKGIQYLTERGFIPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEM
DFQSMELDEALRKFQNHIRVQGEAQKVERLIEAFSQRYCICNPTVVRQFRNPDTIFILAF
AIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPRETLVGIYERIRKRELKTNED
HVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKLQKLGLHQRE
IFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVMLFESQYYPNGIRLTSAIPGADIK
VLINFNAPNPQDRKKFTDDLRESIAEVQEMEKYRIESELEKQKGVVRPSMSQSSGLKKEA
GNGTMNRASLDDTYAMGEGLKRSALSSSLRDLSEAGKRGRRSSAGSLDSNMETSMTLLIL
PLNPLPVACLCM
Download sequence
Identical sequences H3DKQ2
ENSTNIP00000000400 ENSTNIP00000021099 99883.ENSTNIP00000021099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]