SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000440 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000440
Domain Number 1 Region: 28-219
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.64e-30
Family Pentraxin (pentaxin) 0.0000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000440   Gene: ENSTNIG00000001121   Transcript: ENSTNIT00000003159
Sequence length 224
Comment pep:novel chromosome:TETRAODON8:Un_random:38061407:38062443:1 gene:ENSTNIG00000001121 transcript:ENSTNIT00000003159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSVWNVSLFLQVCSGDVVCWTSEGASVRSLVFPSESSSSYVEMVPLRALSLKFTLCMRVA
TELHGDREFILFAYRTPSYDELNVWRESDGSLSFYLSGGAVLFQVPQLGALQTHLCFTWD
SCTGAANVFMDGKKSVTKIYKKGHAIQSGGRVILGQDPDSFLGSFEAKQSLVGEIYDVNM
WDSVLPDSVVHDLFTGMRVPRGNVFDWETTELKINGNVDVVAHE
Download sequence
Identical sequences H3BWS7
ENSTNIP00000000440 99883.ENSTNIP00000000440 ENSTNIP00000000440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]