SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000492 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000492
Domain Number 1 Region: 270-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.8e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000588
Further Details:      
 
Domain Number 2 Region: 426-590
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-39
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000231
Further Details:      
 
Domain Number 3 Region: 143-260
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-35
Family Spermadhesin, CUB domain 0.0000231
Further Details:      
 
Domain Number 4 Region: 644-795
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-32
Family MAM domain 0.0015
Further Details:      
 
Domain Number 5 Region: 25-127
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000089
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000492   Gene: ENSTNIG00000007570   Transcript: ENSTNIT00000002547
Sequence length 941
Comment pep:novel chromosome:TETRAODON8:2:17929275:17964405:1 gene:ENSTNIG00000007570 transcript:ENSTNIT00000002547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKLVKLKWYKSMSLFSLSVLPASEPCGGYLDATNAGYITTPGYPLEYPPHQNCRWVITAP
EASQRIVLNFNPHFEIEKLDCRKVQHNVWLCGCVEFADMPGLYCKRFLPPLSSASLFLRY
QTTDSAEGADMSLKHLTKTGSSDCSRNFTSPSGLIESPGFPDKYPHNLECSFIIVVPPSM
DVTLTFLTFDLENDPLPGGDGDCKYDWLEVWDGLPGVGPLIGRYCGTRVPPEIHSSTGIL
SLSFHTDMAVAKDGFSARYNMTHKEVSETFHCSNAFGMESGKITDDQISASSSFYDERWL
PRQARLNFNDNGWTPNEDSNREYIQVDLHTLKVLTGIATQGAISKETQKAYYVTTFKLEV
STNGEDWMVYRHGKNHKVFHANADATEVVLNRIPQPVLARFVRIRPQAWKNGIALRFELY
GCQITDAPCSELQGMLSGLLPDSQISASSMRDIHGNMGAARLVASRSGWFPNPTQPVAGE
EWLQVDLGVPKMVRGIITQGARGLEGSSSAENRAFVRKYKLAHSLNGKDWTYITDSKTSF
AKIFEGNSHYDTPEVRRFEELVAQYIRVFPERWSPAGIGMRVEVLGCELPETTTVPDTVT
PTMPREEHTTPAMRSVRWLQESHRKLCLTEKRPSQLATTPSLTAVCDFEQSLCGWSADPL
SGVSWSLHTASSGSTGHGTHGFSGNYLHLDAGAHIQRKRARLLSPEVGPEQGPLCLVFYY
QLQGEAQGSLRVLLKDSEQEETLLWALKGEQGSHWREGRTILPQSPKEYQVVFEGFFDHP
TRGHIKIDNIHMSSNIQLEECTHIVAKFKFTSFKTDKIPKIQNRPRDEDETINDYEVRWQ
SSFSTPSTSDVDPPSVTLVSEKDKDNAWLYTLDPILLTIIVMSSLGVLLGAICAGLLLYC
TCSYSGLSSRSSTTLENYNFELYDGIKHKVKINQQRCCSEA
Download sequence
Identical sequences H3C1Q6
ENSTNIP00000002173 ENSTNIP00000000492 99883.ENSTNIP00000002173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]