SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000535 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000535
Domain Number 1 Region: 788-978
Classification Level Classification E-value
Superfamily vWA-like 1.93e-41
Family Integrin A (or I) domain 0.00098
Further Details:      
 
Domain Number 2 Region: 44-236
Classification Level Classification E-value
Superfamily vWA-like 1.24e-29
Family Integrin A (or I) domain 0.0057
Further Details:      
 
Domain Number 3 Region: 1090-1141
Classification Level Classification E-value
Superfamily BPTI-like 8.09e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000535   Gene: ENSTNIG00000018161   Transcript: ENSTNIT00000004046
Sequence length 1143
Comment pep:novel chromosome:TETRAODON8:Un_random:16143243:16151371:1 gene:ENSTNIG00000018161 transcript:ENSTNIT00000004046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMRWLLKVLILTLALAEPIKSQKRRRKGQKDDNEVIVNVSKASTCPVEIMFIVDSSEKAK
FALFEQQKQFVLRFSTKLMELHPLAWRVRLRLAILQYSSTVSVEHNFRDWQDVDVFQGRV
ASMSFIGHGTYSAYAIANATQLFSQETSSNSLRVALLMTDGVDHPRSPSAVTAAAEAKQH
SIRLFAISLLGLPDQGPAGTKLRSIASTPPQQHVISFTDGRLDDRLLGQLNSIVKSQCPQ
PKLCLCEKGDRGLPGNPGKPGEPGSDGVPGPKGSRGQPGINGRPGIEGLEGQSGSKGDKG
EPGECGPPGLKGEKGADGPPGSRGLKGEQGLRGAPGDQGPEGPPGSKGDRGQRGATGPPG
DKGFGFPGPKGERGIQGRVGPPGPVGQGEPGTPGPAGPPGIQGPPGLPGEGLLGSKGDRG
FEGPKGARGPPGVGLKGEKGNTGAPGVPGLMGFPGVGIQGDKGEQGLTGPSGPRGPPGLA
IIGSKGDQGFPGDPGPQGPRGVGEPGPKGEPGPDGPAGTPGIPGEDGASGPKGETGAPGP
RGPEGALGKGVPGEKGDRGDRGPRGLPGSPGPAGSAGPKGEPGSPGMTGPPGSPGRGLPG
PKGESGPAGAAGPLGEPGVGATGPKGNRGNPGAAGPPGEKGDSFPGPPGPPGPPGAHGET
GPEGKGIPGSKGDRGLPGPPGPSGPPGTGFYGPKGSVGQHGPPGPPGPPGEGIQGPKGEP
GFLGPMGPRGAPGDSLPGEKGDRGTPGARGRRGQKGDFGEPGSPGQMQGRPGEKGDAGLT
REEVVRLIRELCGCGFQCRAAPLELVFVIDGSESVGPNFELVKDFVNALVERVWLSQEAA
RMGVVLFSHTSLAVASLQPRSSLSELKATVRSMPYLGEGTFTGSAIHRAHQLFQASRPGV
RKVALVLTDGQADPRDVVQVGVSAAEAQARGIEMFVIGVMNESHPLYPDFSAEMKAIASN
PKEGHVHLIQDFGSLHATPRQRLWKHLGQNLDLEGGETCGSKPSGLQAGTGVSGTPDNHP
TWESRTAQTDTHPDDRDLLLIPEVTFTSAPDPGLTSTTGVQTPGRWMHEGAATPPPPPTT
TEPTPAGLGCGQPLDPGPCRQYVVRWYYDAEANSCAQFWFSGCQGNANNFDSEAKCKHFC
VFT
Download sequence
Identical sequences H3BX22
99883.ENSTNIP00000000535 ENSTNIP00000000535 ENSTNIP00000000535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]