SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000571 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000000571
Domain Number - Region: 64-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00014
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 103-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 8-24
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00978
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000571   Gene: ENSTNIG00000001565   Transcript: ENSTNIT00000001698
Sequence length 175
Comment pep:novel chromosome:TETRAODON8:Un_random:81869690:81870792:-1 gene:ENSTNIG00000001565 transcript:ENSTNIT00000001698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CNSGSDGDGQCLCQPPYSGPRCDQVSSKCSHCSSYSHCNGDGEATSCECLPGYRKTAEGT
CTGVCSAGDCDANGQCSSEGAKISCSCKQGYEGNGKVCIPINPCSKDNGGCPSNSTYCVL
KGPDKSSCECMLGLSPIGGSAESGCQLVSACGEDTCHSTAVCRTGLDGRARCDCT
Download sequence
Identical sequences H3BX58
ENSTNIP00000000571 99883.ENSTNIP00000000571 ENSTNIP00000000571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]