SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000596 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000596
Domain Number 1 Region: 1-387
Classification Level Classification E-value
Superfamily Ras GEF 2.22e-83
Family Ras GEF 0.00056
Further Details:      
 
Domain Number 2 Region: 437-501
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.09e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0018
Further Details:      
 
Domain Number 3 Region: 371-432
Classification Level Classification E-value
Superfamily EF-hand 0.0000000417
Family Calmodulin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000596   Gene: ENSTNIG00000019015   Transcript: ENSTNIT00000002153
Sequence length 503
Comment pep:novel chromosome:TETRAODON8:16:6168199:6171627:-1 gene:ENSTNIG00000019015 transcript:ENSTNIT00000002153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLDELIQRCLNCFDSEGKLSSPKGSQLVHMTLMMHSWVVPSQMFAHKLLTLYPQLSHSSK
HTFLSRCAARQWISQFPAVFEANTLLEQTIEDLWALVRSEGEETNSPFTDTSCLLPRSPH
VNVYRAPSPSMKKRKVSLIFDHMEPDEMAEHLSYLEFKNFCSISFLDYRSYVVQGSVREN
PALERSVMMCNGVSQWVQLMILSRHTAQQRAQVFTKFIHVAQKLRALQNFNTLMAVTGGL
CHSSISRLKDTFNLLPPDITKALSELTELLSSHSNYINYRRVYNECGGFKVPILGVHLKD
LISLNEALPDYISEDKINLSKLQHLYSNISDLLAIHSCTPPFEANKDLLHLLTLSLDLYY
TEDEIYELSYTKEPKNPKIQSIMKNYDQSQDGYISLQDFEEIAANFPFSFCIRKTDRDGQ
ISREEITSYFIRGMSICAKLGYNFNDAHNFHETTYKRPTFCYTCGGFLWGVIKQGYHCKD
CGINCHRHCRDQVGTECSKKQKN
Download sequence
Identical sequences H3BX83
99883.ENSTNIP00000000596 ENSTNIP00000000596 ENSTNIP00000000596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]