SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000798 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000798
Domain Number 1 Region: 1-161
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-44
Family SPRY domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000798   Gene: ENSTNIG00000000013   Transcript: ENSTNIT00000003053
Sequence length 169
Comment pep:novel chromosome:TETRAODON8:3:1321813:1322409:-1 gene:ENSTNIG00000000013 transcript:ENSTNIT00000003053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CELTLDTNTLNRKLQLSDGARTVRFVETEQPYPDHPDRFQWWPQVLCSNGLTGRSYWEVA
CEGRAFVAVSYPSIRRAGEDGHCEFGENDHSWRLNCYGGRYSVCHNSTTTSIRVAVYVDW
PAGLLSFYIVGADSLIHLKTFNTTFSEPLHPGFGFWFWPGSSVSLFPAG
Download sequence
Identical sequences H3BXT5
ENSTNIP00000000798 99883.ENSTNIP00000000798 ENSTNIP00000000798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]