SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000889 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000889
Domain Number 1 Region: 307-520
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.74e-58
Family Reprolysin-like 0.00075
Further Details:      
 
Domain Number 2 Region: 607-664
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000458
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 3 Region: 1397-1454
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000379
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 1204-1261
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000929
Family TSP-1 type 1 repeat 0.0073
Further Details:      
 
Domain Number 5 Region: 1127-1186
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000719
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 6 Region: 1256-1317
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 7 Region: 1575-1629
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000034
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 8 Region: 1075-1129
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000445
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 9 Region: 1458-1514
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000602
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 10 Region: 1344-1398
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000122
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 11 Region: 1691-1746
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000497
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 12 Region: 1014-1075
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000051
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 13 Region: 1632-1692
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000837
Family TSP-1 type 1 repeat 0.007
Further Details:      
 
Domain Number 14 Region: 1512-1570
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000445
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 15 Region: 899-955
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000144
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000889
Domain Number - Region: 953-1015
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0051
Family TSP-1 type 1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000889   Gene: ENSTNIG00000011136   Transcript: ENSTNIT00000003624
Sequence length 1949
Comment pep:novel chromosome:TETRAODON8:11:2495767:2520886:1 gene:ENSTNIG00000011136 transcript:ENSTNIT00000003624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FMFVQYSTLIICMFARESAEHSRPSSALHRPETIYPRVEVKEEIDAYEIVTPVRVNEAGD
KFPTSVHFKRKRRSLDQGADNSTDHWASPNIHYRISAFGHSYHLNLTLESGFIAPLYTVT
VLGVPRGDNITDFATDGEEVPPPAEAAEEEDTELRHCFYKGHVNAQGEHAAVISLCSGLL
GTFRSPEGEYFVEPLHNYQGEHYEEEHTKPHVVYKKRAPKPQTSGESSACDTSGHQHRHR
RHKPKRRQMPRAPPLPDTPPLVGARIFSDLESLSAGLVGASEGSPSGGPSNGSVDSGPHR
RSKRFLSYPRFVEVMLVADSKMVEHHGSNLQHYILTLMSIVSSIYKDPSIGNLISIVVVK
LVIINNELEGPVISFNAQATLKNFCLWQQSQNVLDDNHHSHHDTAILITRQDICRARDKC
DTLGEGLAELGTVCDPYRSCSIIEDNGLSTAFTIAHELGHVFNMPHDDSNKCQEDGVKLQ
QHVMAPTLNYNTNPWMWSKCSRKYITEFLDTGYGECLLDEPISRPYTLPQQLPGQIYNVN
KQCELIFGPGTQVCPYMMQCRRLWCTSPEGAQRGCRTQHMPWADGTDCSPGKHCKHGLCI
AKDNDATPVDGTWGVWSPFGTCSRTCGGGIKIAMRECNRPVPRNGGKYCVGRRMKFRSCN
SEPCSKQKKDFREEQCAAFDGRHFNINGLPPNVRWVPKYSGILMKDRCKLFCRVAGSTAY
YQLRDRVIDGTPCGPDTNDICVQGLCRQAGCDHVLNSKARRDKCGVCGGDNSSCKTVAGT
FNIVHYGYNEVVRIPSGATNIDVRQHSYSGKPDDDNYLAISNSRGEFLLNGEFVVSMFKR
EIKVGNAVIEYSGSDHVIERINCTDRMEEEIVIQVLSVGKLYNPDVRYSFNIPIEDKPQQ
FFWDAYGPWQECSSLCQGVRKRKILCSRESDRVVVSDQRCHGIPRPPVIADPCNTECELR
WHVARKSECTAQCGLGYRTLEIYCAKISHADGKTEKVDDRFCSGQHKPDNKEVCHGDCNP
GGWEYSPWSECSKSCGGGSRRRGAVCRKAAEADGDESRCSQRDKLTSQPCNEFLCPQWKT
GDWSECLVTCGKGYKHRQTWCQFGEDRLDDRLCGSPKPDSVQACQQQECASWQVGPWGQC
TTSCGPGYQMRAVKCVVGPYGAVMDDTECNAATRPTETQDCELAQCPSSHPVPPGIKVLS
HHGHKTQWRFGSWTQCSASCGKGTRMRYVSCRDNQGGVADESACAHLPKPPAREMCSVVA
CGQWKVLEWTACSVTCGQGTTTRQVLCVNFSDQEVNASECDPDDRPATEQDCAMSQCPSR
SSEPRPFPSSPNTSARNNLPHSESHQWRTGPWGACSSTCAGGFQRRVVVCQDENGYPASS
CEDRSRPNEQRSCESGPCPQWIYGNWGECTKPCGGGIKTRLVVCQRPNGERFNDLSCEIH
DKPPDREQCNTQPCPSSPHWSADPWSSCSASCGRGFRVRKVSCLAASGLVISEENCQGLS
LEPSRRRRCRGGRCPKWKTSNWGECSASCGDGVQQREVFCQAGDQRLPEESGCSQRSRPP
TSQSCGNAACPSRYRWREGDWQTCSKSCGGGHRRRALQCEDHDRREFHEMYCANLIRPPD
VESCNSQACEVVWITGEWTECSGSCGQGYRRRLVSCSQVLVEGENYEYGHQSLSNCPGTP
PESYMPCHLDPCPSPQAWWRVGIWGPCSASCGEGVMERVVQCLADGQGCPEDDKPEARKV
CRNPSCHLPNSCQEVQSMNAHFSDGEHVLNVQGRALQVYCAGMQTETPQEYITLTTGEEE
NFSEIFGFSRLNDPTQCPANGSRREDCDCRRDYAAAGITTFSKVRLDINKMNIITTDWRF
AFTREGSNVPFATAGDCYSATACPQGRFRINLSGTGLRVAEAASWVSQGNYAEADVQKSQ
GGSRVSGRCGGYCGKCAPSSDSTLPVTVE
Download sequence
Identical sequences H3D0N5
ENSTNIP00000000889 ENSTNIP00000014071 99883.ENSTNIP00000014071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]