SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001178 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001178
Domain Number 1 Region: 366-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-39
Family SPRY domain 0.00069
Further Details:      
 
Domain Number 2 Region: 166-361
Classification Level Classification E-value
Superfamily Fibronectin type III 1.87e-22
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001178   Gene: ENSTNIG00000009489   Transcript: ENSTNIT00000000023
Sequence length 546
Comment pep:novel chromosome:TETRAODON8:5:9599720:9603480:-1 gene:ENSTNIG00000009489 transcript:ENSTNIT00000000023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKEEGIECETDKVRNQLQEKVAGMESFVGHLEEIFLTVEENFGRREQHLEQHYNDVLQT
LSQRYDERSAGLEAEKKGKLEALYTQLLACGQAMDASKELIEMAQEIYRCQDKRLFLKIS
LYHTRIEEFAKKKVDLTLATRPEFDTPLADLTDVKAMMDSINVIPAPSAPVINPQIPNSA
TQTSLRVCWSLFSDDTVDYYELYYRPVLEDVPADGTQMPQVSKVKVKETHCSVTDLLPNA
QYELWVTATNTTGISPASEKALYMTVPSPPVIKGRECTSCPEAAFISWDSGNTNPVDSYT
VELSEMSAASTHSDVTESIVGVPTCQCVVQLQHGRRYLISVRAVNVGGSSNRSEILTVST
TGTFFHLLEDTAHPCLSISEDGFTIFYEDEELPISAMASDDNTFTRCVAILGDLIPVRGR
HYWEVEVDDDTEFRIGVAYMDTERNSYLGANSTSWCMRHIVTPSRHKYEFLHNGWSPDLR
ITVNPVQIGVALDYQEGTVSFNVDLKQHLHTFRCHFQNYVHPCFGLDSPGALTVHNAIEA
PDYAFV
Download sequence
Identical sequences H3BYW2
ENSTNIP00000001178 99883.ENSTNIP00000001178 ENSTNIP00000001178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]