SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001327 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001327
Domain Number 1 Region: 8-146
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-36
Family C-type lectin domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001327   Gene: ENSTNIG00000000007   Transcript: ENSTNIT00000003128
Sequence length 147
Comment pep:novel chromosome:TETRAODON8:Un_random:36968548:36970007:-1 gene:ENSTNIG00000000007 transcript:ENSTNIT00000003128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLVLSVILCAALAGPAGVSFCPDGWFTHGFRCYIFVNTPMNWYSAKDHCNSLGAHLASVS
SPREYSFLQQMTKTAGQSVAWLGGFHLQHQGRWLWINNEGFYYTNWYTQSSATSYPCMFL
YSTLFSDGWSNTQCTSAKRFICSKTPF
Download sequence
Identical sequences H3BZB1
99883.ENSTNIP00000001327 ENSTNIP00000001327 ENSTNIP00000001327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]