SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001476 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001476
Domain Number 1 Region: 135-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000493
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 2 Region: 204-245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000116
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 3 Region: 95-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000678
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 4 Region: 170-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000151
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 4-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000682
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 6 Region: 53-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000524
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001476
Domain Number - Region: 255-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000875
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001476   Gene: ENSTNIG00000001191   Transcript: ENSTNIT00000003168
Sequence length 280
Comment pep:novel chromosome:TETRAODON8:Un_random:58891670:58895425:-1 gene:ENSTNIG00000001191 transcript:ENSTNIT00000003168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GELCEVNMDECESQPCENGGWCEDGRASYSCHCPQAEEGQVPWGGQRCHVQLFGCVDHQC
LNGAVCQPWLDQGQHGHTCLCPHGFYDDHCSTRKRDWCEGDPCLGQGRCIDLWTSYRCDC
YRPFYGHNCSHGVNRWTSEPCLNGGACEDQFDQFSCACLPGWGGERCQSDLDDCASQPCA
HGSCRDLLAGFQCVCQPGFTGRLCSEDVDDCEDHACEHGGTCQDGVDGYTCACPEDYRGP
RCQWRHPPERCGLHVTCANEGVCADGLWGANCTCAPGFTG
Download sequence
Identical sequences H3C3R2
ENSTNIP00000002881 99883.ENSTNIP00000002881 ENSTNIP00000001476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]