SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001568 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001568
Domain Number 1 Region: 175-353
Classification Level Classification E-value
Superfamily E set domains 5.18e-25
Family Arrestin/Vps26-like 0.015
Further Details:      
 
Domain Number 2 Region: 19-157
Classification Level Classification E-value
Superfamily E set domains 6.37e-16
Family Arrestin/Vps26-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001568   Gene: ENSTNIG00000001081   Transcript: ENSTNIT00000002283
Sequence length 366
Comment pep:novel chromosome:TETRAODON8:12:2651678:2653812:-1 gene:ENSTNIG00000001081 transcript:ENSTNIT00000002283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRPPCKSLKVTHNPINETDTFSNGDSVSGQVTLEVAKDCQISSLSVKFKGKARVLWSERH
GNTTVVYHSKEKYFTFKNYFIRDKKATDDDAEALITTETGEYYSNVVAPGCHVYPFTFQI
PYQIMPPSFKGADGKIVYSLEARLSRSMRIDQKDLTKINFVPNANWSPEHNLREPQHESK
EKKMNLFTSGSVSMDVSLEKTGFCQGEGISVLACIQNNSSREIKPKYCLYRKHSFFAEGK
RRVHTKDLLKEVGNPIPPSASEKVTRVITIPQDIEPSIFNCSIIKAEHRLRVYLDVKYAS
DPEIKFPIVILRAPTVSAAPPFPTASAPYPAAAFGFGNTALPQPPPAPPNPFDPAPSYGT
YNLYPP
Download sequence
Identical sequences H3C109
99883.ENSTNIP00000001925 ENSTNIP00000001568 ENSTNIP00000001925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]