SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001720 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001720
Domain Number 1 Region: 92-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-22
Family SPRY domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001720   Gene: ENSTNIG00000000263   Transcript: ENSTNIT00000002184
Sequence length 218
Comment pep:novel chromosome:TETRAODON8:Un_random:58527467:58529590:1 gene:ENSTNIG00000000263 transcript:ENSTNIT00000002184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTGGGTGLSSRNYRLASDTDKPRTTGVVSERLLSDYLHHVFPSSKPSLRLTPPPSPSR
KPLGFQDLGAHLETLLSEGQPTEDSRDPPADGRLGPQPVVLDHTSGFEGLLFVDDDLLGV
IGHSNFSSIRATTCVFRGKWAYEVLISSQGLMQIGWCTLSCRFNQEEGVGDTPDSYAYDG
NRVRKWNVTTTNYGKSWAAGDIVSCLMDLDEGTIVFCL
Download sequence
Identical sequences H3C0F4
99883.ENSTNIP00000001720 ENSTNIP00000001720 ENSTNIP00000001720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]