SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001765 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001765
Domain Number 1 Region: 209-255
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001765   Gene: ENSTNIG00000001374   Transcript: ENSTNIT00000001826
Sequence length 255
Comment pep:novel chromosome:TETRAODON8:21_random:2543681:2545096:-1 gene:ENSTNIG00000001374 transcript:ENSTNIT00000001826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPASATCATLEQNRFFGVFSSTATLPSTPCSWTLQNPDPRRYSVYMKITKPADPCTPRQI
RTFQFDSFIETSRTYLGMESFDEVVRLCDASTSVTYLESSKQFLQIRKVAPSNSLETLEE
QKDVSEFKAEFLVVGKSEPKHACQMLCQWLEKCLSSSTHDYPCGIMNTPCQCWEAPKRKP
GSCYRGGVYVEKCLPVPRDNGGEAEIIKGWAGWGRWSACSQECSGGVQVRSRSCQPEDGV
CEGTVEEGRACNTQP
Download sequence
Identical sequences H3C0J9
ENSTNIP00000001765 ENSTNIP00000001765 99883.ENSTNIP00000001765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]