SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001771 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001771
Domain Number 1 Region: 229-317
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-17
Family PDZ domain 0.0055
Further Details:      
 
Domain Number 2 Region: 12-95
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-16
Family PDZ domain 0.003
Further Details:      
 
Domain Number 3 Region: 118-208
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000447
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001771   Gene: ENSTNIG00000001627   Transcript: ENSTNIT00000001043
Sequence length 337
Comment pep:novel chromosome:TETRAODON8:Un_random:66729535:66731014:-1 gene:ENSTNIG00000001627 transcript:ENSTNIT00000001043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALCPGAEAGPVPRVCHLKRLEGQNFGFHLQAERSSRALEVRTVEPWSPAELSGLRDGDRV
LEVNEEFVDRMDVQEVAQKIQACGLNLFLLVLNADDYQQAEEAGLDLQALARTSKGDGWS
RPRLCHILRHPDHGLGMSVSAEAGEKGRYTVSTRAQGPAEEAGVRTGDRLVWIDGVMTST
LTHAVLSRMMKRRSQDSVTVLVIDRRAESCFTRRKMAVLPVLAECRGLPYVARTMHLATG
PDGYGFLLRQERLARSRRTVHILREVDAGSPAETAGMEDGDLVLAVNGEPVESMEHDDIV
SRIRRSGDRVSLSTICLAGRHFYRQLGISPLLFRERL
Download sequence
Identical sequences H3C0K5
99883.ENSTNIP00000001771 ENSTNIP00000001771 ENSTNIP00000001771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]