SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001831 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001831
Domain Number 1 Region: 224-462
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-76
Family Eukaryotic proteases 0.00000334
Further Details:      
 
Domain Number 2 Region: 40-103
Classification Level Classification E-value
Superfamily GLA-domain 4.88e-24
Family GLA-domain 0.00023
Further Details:      
 
Domain Number 3 Region: 94-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000021
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 4 Region: 129-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000049
Family EGF-type module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001831   Gene: ENSTNIG00000006589   Transcript: ENSTNIT00000000004
Sequence length 481
Comment pep:novel chromosome:TETRAODON8:3:1189769:1192216:1 gene:ENSTNIG00000006589 transcript:ENSTNIT00000000004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASSLANSSLCLSLRNITVKIFTAFLDKNNAAQVLSRRRRANSFLEELKQGNMERECNEE
RCSLEEAREIFEDADKTNDFWAVYIDGDACKSIPCANNGRCKDGIGTYTCFCPTGYQGFN
CEIVIPQLCEKENGGCEHFCHVVRGNVQCSCAGGYSLASDDKSCHSSEKFRCGGIVQENT
RTVFLYDRQNTTTDGQNITSLINSTESFSKVSSDNQKEERIISEMAQKTRIVNGENCPPG
ECPWQAVLMNEDHRWFCGGTILNQYIILTAAHCMNETNYFYVKLGEFDMLVDEGNEAIHE
VETILAHNKYLPDTYHNDIALIKLVTPITYSKFILPACIPEQEFAESVLMQQPDGMISGF
GRFRENRPTSPIQRLTIPYVDRRTCIESTSLRISTRMFCAGYDDIAKDACQGDSGGPHVT
SYRDTYFVTGIVSWGEGCARKGKYGVYTQVSKYIGWIHDGIKRLVPHEQSTRSKRHYGPI
K
Download sequence
Identical sequences H3CM82
99883.ENSTNIP00000009363 ENSTNIP00000001831 ENSTNIP00000009363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]